2CPN: Second dsRBD of TAR RNA-binding protein 2

Solution structure of the second dsRBD of TAR RNA-binding protein 2. Determined by solution NMR. Released 19 Nov 2005.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 662
Mol. weight: 9.49 kDa
Released: 19 Nov 2005

Explore 2CPN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2CPN contains 2 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	160-171	12
β-strand	177-184	8	1
β-strand	191-198	8	1
β-strand	201-207	7	1
α-helix	210-226	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
TAR RNA-binding protein 2	A	protein	89	Homo sapiens	Q15633 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2CPN_1 TAR RNA-binding protein 2 (chains A)
GSSGSSGPVSPQQSECNPVGALQELVVQKGWRLPEYTVTQESGPAHRKEFTMTCRVERFI
EIGSGTSKKLAKRNAAAKMLLRVSGPSSG

Primary citation

Solution structure of the second dsRBD of TAR RNA-binding protein 2. Nagata, T., Muto, Y., Inoue, M. et al. To be published.

Other PDB entries of the same protein (UniProt Q15633 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6ZBK 1.49 Å, Crystal structure of the human complex between RPAP3 and TRBP
3LLH 2.14 Å, Crystal structure of the first dsRBD of TAR RNA-binding protein 2
3ADL 2.2 Å, Structure of TRBP2 and its molecule implications for miRNA processing
4WYQ 3.2 Å, Crystal structure of the Dicer-TRBP interface
5ZAK 4.4 Å, Cryo-EM structure of human Dicer and its complexes with a pre-miRNA substrate
5ZAL 4.7 Å, Cryo-EM structure of human Dicer and its complexes with a pre-miRNA substrate
5ZAM 5.7 Å, Cryo-EM structure of human Dicer and its complexes with a pre-miRNA substrate
5N8L Structure of TRBP dsRBD 1 and 2 in complex with a 19 bp siRNA (Complex B)
5N8M Structure of TRBP dsRBD 1 and 2 in complex with a 19 bp siRNA (Complex A)

Browse structure collections

About this viewer

MolViewer shows 2CPN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.