3ADL: RISC-loading complex subunit TARBP2

Structure of TRBP2 and its molecule implications for miRNA processing. Determined by X-ray diffraction at 2.2 Å resolution. Released 26 May 2010.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 3
Atoms: 1,072
Mol. weight: 16.35 kDa
Released: 26 May 2010

Explore 3ADL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3ADL contains 4 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	154-155	2
α-helix	160-170	11
α-helix	174-176	3
β-strand	177-184	8	1
β-strand	191-198	8	1
β-strand	201-207	7	1
α-helix	210-226	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RISC-loading complex subunit TARBP2	A	protein	88	Homo sapiens	Q15633 (AlphaFold model)
RNA (5'-r(pcpgpcpgpcpgpcpgpcpg)-3')	B, C	RNA	10

Sequence of entity 1 (A), FASTA

>3ADL_1 RISC-loading complex subunit TARBP2 (chains A)
HHHHHHSSGLVPRGSHEVGALQELVVQKGWRLPEYTVTQESGPAHRKEFTMTCRVERFIE
IGSGTSKKLAKRNAAAKMLLRVHTVPLD

Sequence of entity 2 (B, C), FASTA

>3ADL_2 RNA (5'-R(P*CP*GP*CP*GP*CP*GP*CP*GP*CP*G)-3') (chains B, C)
CGCGCGCGCG

Primary citation

Structure of arabidopsis HYPONASTIC LEAVES1 and its molecular implications for miRNA processing. Yang, S.W., Chen, H.Y., Yang, J. et al. Structure (2010) 18:594-605. DOI 10.1016/j.str.2010.02.006 · PubMed

Other PDB entries of the same protein (UniProt Q15633 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6ZBK 1.49 Å, Crystal structure of the human complex between RPAP3 and TRBP
3LLH 2.14 Å, Crystal structure of the first dsRBD of TAR RNA-binding protein 2
4WYQ 3.2 Å, Crystal structure of the Dicer-TRBP interface
5ZAK 4.4 Å, Cryo-EM structure of human Dicer and its complexes with a pre-miRNA substrate
5ZAL 4.7 Å, Cryo-EM structure of human Dicer and its complexes with a pre-miRNA substrate
5ZAM 5.7 Å, Cryo-EM structure of human Dicer and its complexes with a pre-miRNA substrate
2CPN Solution structure of the second dsRBD of TAR RNA-binding protein 2
5N8L Structure of TRBP dsRBD 1 and 2 in complex with a 19 bp siRNA (Complex B)
5N8M Structure of TRBP dsRBD 1 and 2 in complex with a 19 bp siRNA (Complex A)

Browse structure collections

About this viewer

MolViewer shows 3ADL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.