3LLH: First dsRBD of TAR RNA-binding protein 2

Crystal structure of the first dsRBD of TAR RNA-binding protein 2. Determined by X-ray diffraction at 2.14 Å resolution. Released 8 Dec 2010.

Method: X-ray diffraction
Resolution: 2.14 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,023
Mol. weight: 18.98 kDa
Ligands: MLI
Released: 8 Dec 2010

Explore 3LLH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3LLH contains 4 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	16-26	11
β-strand	32-38	7	1
β-strand	47-53	7	1
β-strand	56-62	7	1
α-helix	65-80	16

Chain B: 2 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	16-26	11
β-strand	32-39	8	2
β-strand	46-53	8	2
β-strand	56-62	7	2
α-helix	65-80	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RISC-loading complex subunit TARBP2	A, B	protein	90	Homo sapiens	Q15633 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3LLH_1 RISC-loading complex subunit TARBP2 (chains A, B)
GPLGSHMLAANPGKTPISLLQEYGTRIGKTPVYDLLKAEGQAHQPNFTFRVTVGDTSCTG
QGPSKKAAKHKAAEVALKHLKGGSMLEPAL

Ligands and cofactors

ID	Name	Formula	Copies
MLI	Malonate ion	C3 H2 O4	1

Primary citation

The structures of dsRBDs of human TRBP. Yamashita, S., Nagata, T., Kawazoe, M. et al. To be published.

Other PDB entries of the same protein (UniProt Q15633 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6ZBK 1.49 Å, Crystal structure of the human complex between RPAP3 and TRBP
3ADL 2.2 Å, Structure of TRBP2 and its molecule implications for miRNA processing
4WYQ 3.2 Å, Crystal structure of the Dicer-TRBP interface
5ZAK 4.4 Å, Cryo-EM structure of human Dicer and its complexes with a pre-miRNA substrate
5ZAL 4.7 Å, Cryo-EM structure of human Dicer and its complexes with a pre-miRNA substrate
5ZAM 5.7 Å, Cryo-EM structure of human Dicer and its complexes with a pre-miRNA substrate
2CPN Solution structure of the second dsRBD of TAR RNA-binding protein 2
5N8L Structure of TRBP dsRBD 1 and 2 in complex with a 19 bp siRNA (Complex B)
5N8M Structure of TRBP dsRBD 1 and 2 in complex with a 19 bp siRNA (Complex A)

Browse structure collections

About this viewer

MolViewer shows 3LLH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.