6ZBK: Human complex between RPAP3 and TRBP

Crystal structure of the human complex between RPAP3 and TRBP. Determined by X-ray diffraction at 1.49 Å resolution. Released 30 Jun 2021.

Method: X-ray diffraction
Resolution: 1.49 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,944
Mol. weight: 25.66 kDa
Released: 30 Jun 2021

Explore 6ZBK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6ZBK contains 15 α-helices and 5 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	134-145	12
α-helix	149-162	14
α-helix	168-179	12
α-helix	183-196	14
α-helix	201-213	13
α-helix	217-230	14
α-helix	235-248	14

Chain B: 8 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	264	1	1
α-helix	265-270	6
α-helix	274-281	8
α-helix	285-289	5
α-helix	291-293	3
α-helix	294-305	12
β-strand	309-314	6	2
α-helix	317-318	2
β-strand	323-329	7	2
β-strand	332	1	1
α-helix	334	1
β-strand	335-341	7	2
α-helix	344-364	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RNA polymerase II-associated protein 3	A	protein	123	Homo sapiens	Q9H6T3 (AlphaFold model)
RISC-loading complex subunit TARBP2	B	protein	109	Homo sapiens	Q15633 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6ZBK_1 RNA polymerase II-associated protein 3 (chains A)
ALVLKEKGNKYFKQGKYDEAIDCYTKGMDADPYNPVLPTNRASAYFRLKKFAVAESDCNL
AVALNRSYTKAYSRRGAARFALQKLEEAKKDYERVLELEPNNFEATNELRKISQALASKE
NSY

Sequence of entity 2 (B), FASTA

>6ZBK_2 RISC-loading complex subunit TARBP2 (chains B)
GPHMGCTWDSLRNSVGEKILSLRSCSLGSLGALGPACCRVLSELSEEQAFHVSYLDIEEL
SLSGLCQCLVELSTQPATVCHGSATTREAARGEAARRALQYLKIMAGSK

Primary citation

The interaction between RPAP3 and TRBP reveals a possible involvement of the HSP90/R2TP chaperone complex in the regulation of miRNA activity. Abel, Y., Charron, C., Virciglio, C. et al. Nucleic Acids Res (2022) 50:2172-2189. DOI 10.1093/nar/gkac086 · PubMed

Other PDB entries of the same protein (UniProt Q9H6T3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6FM8 1.78 Å, RPAP3 c-terminus
4CGV 2.54 Å, First TPR of Spaghetti (RPAP3) bound to HSP90 peptide SRMEEVD
6GXZ 2.96 Å, Crystal structure of the human RPAP3(TPR2)-PIH1D1(CS) complex
4CGW 3.0 Å, Second TPR of Spaghetti (RPAP3) bound to HSP90 peptide SRMEEVD
6FO1 3.57 Å, Human R2TP subcomplex containing 1 RUVBL1-RUVBL2 hexamer bound to 1 RBD domain from RPAP3.
6EZ4 NMR structure of the C-terminal domain of the human RPAP3 protein
6FD7 NMR structure of the first TPR domain of the human RPAP3 protein
6FDP NMR structure of the second TPR domain of the human RPAP3 protein in complex with HSP90…
6FDT NMR structure of the second TPR domain of the human RPAP3 protein in complex with HSP70…

Browse structure collections

About this viewer

MolViewer shows 6ZBK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.