5N8L: TRBP dsRBD 1 and 2

Structure of TRBP dsRBD 1 and 2 in complex with a 19 bp siRNA (Complex B). Determined by solution NMR. Released 21 Feb 2018.

Method: Solution NMR
Organisms: Homo sapiens, synthetic construct
Chains: 3
Atoms: 2,055
Mol. weight: 36.29 kDa
Released: 21 Feb 2018

Explore 5N8L in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5N8L contains 7 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	15-18	4
α-helix	21-25	5
α-helix	31-42	12
β-strand	47-54	8	1
β-strand	61-68	8	1
β-strand	71-77	7	1
α-helix	80-95	16
α-helix	160-170	11
α-helix	173-176	4
β-strand	177-184	8	2
β-strand	191-197	7	2
β-strand	202-207	6	2
α-helix	210-225	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RISC-loading complex subunit TARBP2	A	protein	215	Homo sapiens	Q15633 (AlphaFold model)
RNA (5'-r(upupapapupupapupcpupapupupcpcpgpupapcpup*u)-3')	B	RNA	21	synthetic construct
RNA (5'-r(gpupapcpgpgpapapupapgpapupapapupupapapup*u)-3')	C	RNA	21	synthetic construct

Sequence of entity 1 (A), FASTA

>5N8L_1 RISC-loading complex subunit TARBP2 (chains A)
GGSLPSIEQMLAANPGKTPISLLQEYGTRIGKTPVYDLLKAEGQAHQPNFTFRVTVGDTS
CTGQGPSKKAAKHKAAEVALKHLKGGSMLEPALEDSSSFSPLDSSLPEDIPVFTAAAAAT
PVPSVVLTRSPPMELQPPVSPQQSECNPVGALQELVVQKGWRLPEYTVTQESGPAHRKEF
TMTCRVERFIEIGSGTSKKLAKRNAAAKMLLRVHT

Sequence of entity 2 (B), FASTA

>5N8L_2 RNA (5'-R(*UP*UP*AP*AP*UP*UP*AP*UP*CP*UP*AP*UP*UP*CP*CP*GP*UP*AP*CP*UP*U)-3') (chains B)
UUAAUUAUCUAUUCCGUACUU

Sequence of entity 3 (C), FASTA

>5N8L_3 RNA (5'-R(*GP*UP*AP*CP*GP*GP*AP*AP*UP*AP*GP*AP*UP*AP*AP*UP*UP*AP*AP*UP*U)-3') (chains C)
GUACGGAAUAGAUAAUUAAUU

Primary citation

Structural basis of siRNA recognition by TRBP double-stranded RNA binding domains. Masliah, G., Maris, C., Konig, S.L. et al. EMBO J (2018) 37. DOI 10.15252/embj.201797089 · PubMed

Other PDB entries of the same protein (UniProt Q15633 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6ZBK 1.49 Å, Crystal structure of the human complex between RPAP3 and TRBP
3LLH 2.14 Å, Crystal structure of the first dsRBD of TAR RNA-binding protein 2
3ADL 2.2 Å, Structure of TRBP2 and its molecule implications for miRNA processing
4WYQ 3.2 Å, Crystal structure of the Dicer-TRBP interface
5ZAK 4.4 Å, Cryo-EM structure of human Dicer and its complexes with a pre-miRNA substrate
5ZAL 4.7 Å, Cryo-EM structure of human Dicer and its complexes with a pre-miRNA substrate
5ZAM 5.7 Å, Cryo-EM structure of human Dicer and its complexes with a pre-miRNA substrate
2CPN Solution structure of the second dsRBD of TAR RNA-binding protein 2
5N8M Structure of TRBP dsRBD 1 and 2 in complex with a 19 bp siRNA (Complex A)

Browse structure collections

About this viewer

MolViewer shows 5N8L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.