2EYX: C-Terminal SH3 domain of CT10-Regulated Kinase

C-Terminal SH3 domain of CT10-Regulated Kinase. Determined by solution NMR. Released 10 Nov 2006.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 533
Mol. weight: 7.57 kDa
Released: 10 Nov 2006

Explore 2EYX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2EYX contains 2 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	239	1	1
β-strand	240-242	3	2
β-strand	246	1	3
α-helix	247-249	3
β-strand	255	1	2
β-strand	258	1	3
β-strand	262-269	8	2
β-strand	274-279	6	2
β-strand	282-287	6	2
α-helix	288-290	3
β-strand	291	1	2
β-strand	294	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
v-crk sarcoma virus CT10 oncogene homolog isoform a	A	protein	67	Homo sapiens	P46108 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2EYX_1 v-crk sarcoma virus CT10 oncogene homolog isoform a (chains A)
NLQNGPIYARVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHV
RLLDQQN

Primary citation

Structural basis for the transforming activity of human cancer-related signaling adaptor protein CRK. Kobashigawa, Y., Sakai, M., Naito, M. et al. Nat Struct Mol Biol (2007) 14:503-510. DOI 10.1038/nsmb1241 · PubMed

Other PDB entries of the same protein (UniProt P46108 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5UL6 1.45 Å, The molecular mechanisms by which NS1 of the 1918 Spanish influenza A virus hijack host…
6ATV 1.75 Å, The molecular mechanisms by which NS1 of the 1918 Spanish influenza A virus hijack host…
1JU5 Ternary complex of an Crk SH2 domain, Crk-derived phophopeptide, and Abl SH3 domain by…
2DVJ phosphorylated Crk-II
2EYV SH2 domain of CT10-Regulated Kinase
2EYW N-terminal SH3 domain of CT10-Regulated Kinase
2EYY CT10-Regulated Kinase isoform I
2EYZ CT10-Regulated Kinase isoform II
2MS4 Cyclophilin a complexed with a fragment of crk-ii

Browse structure collections

About this viewer

MolViewer shows 2EYX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.