2FCP: Protein

Ferric hydroxamate uptake receptor (FHUA) from e.coli. Determined by X-ray diffraction at 2.5 Å resolution. Released 13 Jan 1999.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Escherichia coli
Chains: 1
Atoms: 5,833
Mol. weight: 83.37 kDa
Ligands: EA2, LIM, AAE, LIL
Released: 13 Jan 1999

Explore 2FCP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2FCP contains 15 α-helices and 43 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 43 β-strands

Element	Residues	Length	Sheet
α-helix	24-29	6
β-strand	32-33	2	1
β-strand	41-42	2	1
α-helix	43-45	3
β-strand	50-54	5	2
α-helix	55-61	7
α-helix	66-69	4
β-strand	76-77	2	3
β-strand	91-92	2	3
β-strand	95	1	3
α-helix	98-100	3
β-strand	104-106	3	2
β-strand	109-110	2	2
β-strand	114	1	4
β-strand	117	1	4
α-helix	123-125	3
β-strand	126-133	8	2
α-helix	137-140	4
β-strand	147-153	7	2
β-strand	161-169	9	5
α-helix	170-172	3
β-strand	174-183	10	5
β-strand	190-202	13	5
β-strand	209-221	13	5
β-strand	227-238	12	5
β-strand	247	1	6
β-strand	250	1	7
β-strand	254	1	7
β-strand	274-289	16	5
β-strand	294-317	24	5
α-helix	321-323	3
α-helix	327-330	4
α-helix	337-339	3
β-strand	340-366	27	5
β-strand	371-401	31	5
α-helix	407-410	4
β-strand	429-450	22	5
β-strand	454-471	18	5
β-strand	476-493	18	5
β-strand	499-510	12	5
β-strand	515	1	8
β-strand	521	1	8
α-helix	522-524	3
β-strand	525-536	12	5
β-strand	543-560	18	5
β-strand	568-586	19	5
β-strand	591-606	16	5
α-helix	613-615	3
β-strand	621-631	11	5
β-strand	639-648	10	5
β-strand	651-652	2	9
β-strand	660-661	2	9
α-helix	662-663	2
β-strand	664-673	10	5
β-strand	684-690	7	5
β-strand	698-703	6	6
β-strand	706-709	4	6
β-strand	714-722	9	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (ferric hydroxamate uptake receptor)	A	protein	723	Escherichia coli	P06971 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2FCP_1 PROTEIN (FERRIC HYDROXAMATE UPTAKE RECEPTOR) (chains A)
AVEPKEDTITVTAAPAPQESAWGPAATIAARQSATGTKTDTPIQKVPQSISVVTAEEMAL
HQPKSVKEALSYTPGVSVGTRGASNTYDHLIIRGFAAEGQSQNNYLNGLKLQGNFYNDAV
IDPYMLERAEIMRGPVSVLYGKSSPGGLLNMVSKRPTTEPLKEVQFKAGTDSLFQTGFDF
SDSLDDDGVYSYRLTGLARSANAQQKGSEEQRYAIAPAFTWRPDDKTNFTFLSYFQNEPE
TGYYGWLPKEGTVEPLPNGKRLPTDFNEGAKNNTYSRNEKMVGYSFDHEFNDTFTVRQNL
RFAENKTSQNSVYGYGVCSDPANAYSKQCAALAPADKGHYLARKYVVDDEKLQNFSVDTQ
LQSKFATGDIDHTLLTGVDFMRMRNDINAWFGYDDSVPLLNLYNPSHHHHHHGSVNTDFD
FNAKDPANSGPYRILNKQKQTGVYVQDQAQWDKVLVTLGGRYDWADQESLNRVAGTTDKR
DDKQFTWRGGVNYLFDNGVTPYFSYSESFEPSSQVGKDGNIFAPSKGKQYEVGVKYVPED
RPIVVTGAVYNLTKTNNLMADPEGSFFSVEGGEIRARGVEIEAKAALSASVNVVGSYTYT
DAEYTTDTTYKGNTPAQVPKHMASLWADYTFFDGPLSGLTLGTGGRYTGSSYGDPANSFK
VGSYTVVDALVRYDLARVGMAGSNVALHVNNLFDREYVASCFNTYGCFWGAERQVVATAT
FRF

Ligands and cofactors

ID	Name	Formula	Copies
EA2	Aminoethanolpyrophosphate	C2 H9 N O7 P2	1
LIM	3-oxo-pentadecanoic acid	C15 H28 O3	1
AAE	Acetoacetic acid	C4 H6 O3	1
LIL	2-tridecanoyloxy-pentadecanoic acid	C28 H54 O4	2
NI	Nickel (II) ion	Ni	2

Primary citation

Siderophore-mediated iron transport: crystal structure of FhuA with bound lipopolysaccharide. Ferguson, A.D., Hofmann, E., Coulton, J.W. et al. Science (1998) 282:2215-2220. DOI 10.1126/science.282.5397.2215 · PubMed

Other PDB entries of the same protein (UniProt P06971 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4CU4 2.3 Å, FhuA from E. coli in complex with the lasso peptide microcin J25 (MccJ25)
1QFG 2.5 Å, E. Coli ferric hydroxamate receptor (FHUA)
1BY5 2.6 Å, Fhua from E. Coli, with its ligand ferrichrome
8B14 2.6 Å, T5 Receptor Binding Protein pb5 in complex with its E. coli receptor FhuA
1FCP 2.7 Å, Ferric hydroxamate uptake receptor (FHUA) from e.coli in complex with bound…
1QFF 2.7 Å, E. Coli ferric hydroxamate uptake receptor (FHUA) in complex with bound ferrichrome-iron
1BY3 2.74 Å, Fhua from E. Coli
1FI1 2.9 Å, FhuA in complex with lipopolysaccharide and rifamycin CGP4832
1QJQ 2.95 Å, Ferric hydroxamate receptor from escherichia coli (FHUA)
1QKC 3.1 Å, Escherichia coli ferric hydroxamate uptake receptor (FHUA) in complex delta two-albomycin
8A8C 3.1 Å, T5 phage receptor-binding protein pb5 bound to ferrichrome transporter FhuA
2GRX 3.3 Å, Crystal structure of TonB in complex with FhuA, E. coli outer membrane receptor for…

Browse structure collections

About this viewer

MolViewer shows 2FCP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.