Crystal structure of the A49M mutant CAP-Gly domain of human Dynactin-1 (p150-Glued) in complex with human EB1 C-terminal hexapeptide. Determined by X-ray diffraction at 2.03 Å resolution. Released 12 Sept 2006.
Explore 2HL3 in 3D Show helices and sheets RCSB PDB PDBe
2HL3 contains 3 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 32-36 | 5 | 1 |
| β-strand | 40-48 | 9 | 2 |
| β-strand | 57-62 | 6 | 2 |
| β-strand | 69 | 1 | 2 |
| β-strand | 72-73 | 2 | 3 |
| β-strand | 76-77 | 2 | 3 |
| β-strand | 86-89 | 4 | 2 |
| α-helix | 91-93 | 3 | |
| β-strand | 94-96 | 3 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 32-35 | 4 | 2 |
| α-helix | 36-38 | 3 | |
| β-strand | 39-49 | 11 | 1 |
| β-strand | 56-62 | 7 | 1 |
| β-strand | 69 | 1 | 1 |
| β-strand | 72-73 | 2 | 4 |
| β-strand | 76-77 | 2 | 4 |
| β-strand | 86-89 | 4 | 1 |
| α-helix | 91-93 | 3 | |
| β-strand | 94-96 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Dynactin-1 | A, B | protein | 97 | Homo sapiens | Q14203 (AlphaFold model) |
| Microtubule-associated protein RP/EB family member 1 | C | protein | 6 | Q15691 (AlphaFold model) |
>2HL3_1 Dynactin-1 (chains A, B) GSHMSAEASARPLRVGSRVEVIGKGHRGTVAYVGMTLFATGKWVGVILDEAKGKNDGTVQ GRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPETPDS
>2HL3_2 Microtubule-associated protein RP/EB family member 1 (chains C) EEQEEY
Key interaction modes of dynamic +TIP networks. Honnappa, S., Okhrimenko, O., Jaussi, R. et al. Mol Cell (2006) 23:663-671. DOI 10.1016/j.molcel.2006.07.013 · PubMed
Other PDB entries of the same protein (UniProt Q14203 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2HL3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.