2HL3: A49M mutant CAP-Gly domain of human Dynactin-1

Crystal structure of the A49M mutant CAP-Gly domain of human Dynactin-1 (p150-Glued) in complex with human EB1 C-terminal hexapeptide. Determined by X-ray diffraction at 2.03 Å resolution. Released 12 Sept 2006.

Method: X-ray diffraction
Resolution: 2.03 Å
Organism: Homo sapiens
Chains: 3
Atoms: 1,236
Mol. weight: 21.56 kDa
Released: 12 Sept 2006

Explore 2HL3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2HL3 contains 3 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 8 β-strands

Element	Residues	Length	Sheet
β-strand	32-36	5	1
β-strand	40-48	9	2
β-strand	57-62	6	2
β-strand	69	1	2
β-strand	72-73	2	3
β-strand	76-77	2	3
β-strand	86-89	4	2
α-helix	91-93	3
β-strand	94-96	3	2

Chain B: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	32-35	4	2
α-helix	36-38	3
β-strand	39-49	11	1
β-strand	56-62	7	1
β-strand	69	1	1
β-strand	72-73	2	4
β-strand	76-77	2	4
β-strand	86-89	4	1
α-helix	91-93	3
β-strand	94-96	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Dynactin-1	A, B	protein	97	Homo sapiens	Q14203 (AlphaFold model)
Microtubule-associated protein RP/EB family member 1	C	protein	6		Q15691 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2HL3_1 Dynactin-1 (chains A, B)
GSHMSAEASARPLRVGSRVEVIGKGHRGTVAYVGMTLFATGKWVGVILDEAKGKNDGTVQ
GRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPETPDS

Sequence of entity 2 (C), FASTA

>2HL3_2 Microtubule-associated protein RP/EB family member 1 (chains C)
EEQEEY

Primary citation

Key interaction modes of dynamic +TIP networks. Honnappa, S., Okhrimenko, O., Jaussi, R. et al. Mol Cell (2006) 23:663-671. DOI 10.1016/j.molcel.2006.07.013 · PubMed

Other PDB entries of the same protein (UniProt Q14203 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1TXQ 1.8 Å, Crystal structure of the EB1 C-terminal domain complexed with the CAP-Gly domain of…
2HQH 1.8 Å, Crystal structure of p150Glued and CLIP-170
2HKQ 1.86 Å, Crystal structure of the C-terminal domain of human EB1 in complex with the CAP-Gly…
2HKN 1.87 Å, Crystal structure of the CAP-Gly domain of human Dynactin-1 (p150-Glued)
2HL5 1.93 Å, Crystal structure of the C-terminal domain of human EB1 in complex with the A49M mutant…
3TQ7 2.3 Å, EB1c/EB3c heterodimer in complex with the CAP-Gly domain of P150glued
3E2U 2.6 Å, Crystal structure of the zink-knuckle 2 domain of human CLIP-170 in complex with CAP-Gly…
9B7J 3.49 Å, Cryo-EM structure of human dynactin complex bound to Chlamydia effector Dre1
9YND 4.26 Å, Motor domain of human dynein-1 in pre-power stroke bound to dynactin-p150glued-CC1B and…
9YNH 5.5 Å, Full-length human cytoplasmic dynein-1 in phi-like state bound to dynactin-p150glued and…
9YNE 8.46 Å, Motor domain of human dynein-1 in pre-power stroke bound to dynactin-p150glued-CC1B-ICD…
2COY Solution structure of the CAP-Gly domain in human Dynactin 1

Browse structure collections

About this viewer

MolViewer shows 2HL3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.