2LO4: Optineurin Zinc-finger Domain

NMR Solution Structure of Optineurin Zinc-finger Domain. Determined by solution NMR. Released 23 Jan 2013.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 215
Mol. weight: 5.63 kDa
Ligands: ZN
Released: 23 Jan 2013

Explore 2LO4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LO4 contains 1 α-helix and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	40-48	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Optineurin	A	protein	51	Homo sapiens	Q96CV9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2LO4_1 Optineurin (chains A)
MGSSHHHHHHSSGLVPRGSHMASIPIHSCPKCGEVLPDIDTLQIHVMDCII

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Primary citation

NMR Solution Structure of Optineurin Zinc-finger Domain. Wilson, R.C., Caudle, T.H., Wolfsberger, J. et al. To be published.

Other PDB entries of the same protein (UniProt Q96CV9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3VTV 1.7 Å, Crystal structure of Optineurin LIR-fused human LC3B_2-119
9B0B 1.7 Å, Structure of Optineurin bound to HOIP NZF1 domain
9B12 1.81 Å, Structure of Optineurin bound to HOIP NZF1 domain and M1-linked diubiquitin, crystal…
9M0O 1.83 Å, Crystal structure of OPTN 138-170 in complex with GTP-bound RAB8A1-176 (Q67L)
9IKQ 1.93 Å, Crystal structure of OPTN LZD in complex with GTP-bound Rab8a(Q67L)
7CZM 2.0 Å, Crystal structure of FIP200 Claw/p-OPtineurin LIR complex
5EOF 2.05 Å, Crystal structure of OPTN NTD and TBK1 CTD complex
9B0Z 2.41 Å, Structure of Optineurin bound to HOIP NZF1 domain and M1-linked diubiquitin, crystal…
5EOA 2.5 Å, Crystal structure of OPTN E50K mutant and TBK1 complex
3VTW 2.52 Å, Crystal structure of T7-tagged Optineurin LIR-fused human LC3B_2-119
5B83 2.69 Å, Crystal structure of Optineurin UBAN in complex with linear ubiquitin
2LUE LC3B OPTN-LIR Ptot complex structure

Browse structure collections

About this viewer

MolViewer shows 2LO4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.