Crystal structure of T7-tagged Optineurin LIR-fused human LC3B_2-119. Determined by X-ray diffraction at 2.52 Å resolution. Released 26 Jun 2013.
Explore 3VTW in 3D Show helices and sheets RCSB PDB PDBe
3VTW contains 21 α-helices and 21 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 17-21 | 5 | |
| α-helix | 22-25 | 4 | |
| α-helix | 28-41 | 14 | |
| β-strand | 45-52 | 8 | 1 |
| α-helix | 60-62 | 3 | |
| β-strand | 66-70 | 5 | 1 |
| β-strand | 74 | 1 | 2 |
| α-helix | 75-85 | 11 | |
| β-strand | 95-98 | 4 | 1 |
| β-strand | 101-102 | 2 | 1 |
| β-strand | 109 | 1 | 2 |
| α-helix | 110-117 | 8 | |
| α-helix | 123 | 1 | |
| β-strand | 124-129 | 6 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 18-21 | 4 | |
| α-helix | 22-25 | 4 | |
| α-helix | 28-41 | 14 | |
| β-strand | 45-52 | 8 | 3 |
| α-helix | 60-62 | 3 | |
| β-strand | 66-70 | 5 | 3 |
| β-strand | 74 | 1 | 4 |
| α-helix | 75-86 | 12 | |
| β-strand | 95-98 | 4 | 3 |
| β-strand | 101-102 | 2 | 3 |
| β-strand | 109 | 1 | 4 |
| α-helix | 110-117 | 8 | |
| α-helix | 123 | 1 | |
| β-strand | 124-129 | 6 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 18-21 | 4 | |
| α-helix | 22-25 | 4 | |
| α-helix | 28-41 | 14 | |
| β-strand | 45-52 | 8 | 5 |
| α-helix | 60-62 | 3 | |
| β-strand | 66-70 | 5 | 5 |
| β-strand | 74 | 1 | 6 |
| α-helix | 75-85 | 11 | |
| β-strand | 95-98 | 4 | 5 |
| β-strand | 101 | 1 | 5 |
| β-strand | 109 | 1 | 6 |
| α-helix | 110-117 | 8 | |
| α-helix | 123 | 1 | |
| β-strand | 124-129 | 6 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Optineurin, microtubule-associated proteins 1A/1B light chain 3B | A, B, C | protein | 149 | Homo sapiens | Q96CV9 (AlphaFold model), Q9GZQ8 (AlphaFold model) |
>3VTW_1 Optineurin, microtubule-associated proteins 1A/1B light chain 3B (chains A, B, C) GSHMASMTGGQQMGRGSEEGEEEDEFVEIGGPSEKTFKQRRTFEQRVEDVRLIREQHPTK IPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVS VSTPISEVYESEKDEDGFLYMVYASQETF
Structural basis for phosphorylation-triggered autophagic clearance of Salmonella. Rogov, V.V., Suzuki, H., Fiskin, E. et al. Biochem J (2013) 454:459-466. DOI 10.1042/BJ20121907 · PubMed
Other PDB entries of the same protein (UniProt Q96CV9 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3VTW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.