2MQE: PDB entry 2MQE

Name: PDB 2MQE: Solution structure of Escherichia coli Outer membrane protein A C-terminal domain
Published: 2014-09-03
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: membrane protein

Solution structure of Escherichia coli Outer membrane protein A C-terminal domain. Determined by solution NMR. Released 3 Sept 2014.

Method: Solution NMR
Organism: Escherichia coli
Chains: 1
Atoms: 1,103
Mol. weight: 15.71 kDa
Released: 3 Sept 2014

Explore 2MQE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2MQE contains 8 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	188-189	2
β-strand	192-197	6	1
α-helix	198-201	4
α-helix	208-210	3
α-helix	211-225	15
β-strand	233-239	7	1
α-helix	246-265	20
β-strand	274-280	7	1
α-helix	286-289	4
α-helix	296-302	7
β-strand	308-314	7	1
α-helix	319-322	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
OmpA domain protein transmembrane region-containing protein	A	protein	146	Escherichia coli	P0A910 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2MQE_1 OmpA domain protein transmembrane region-containing protein (chains A)
APAPAPAPEVQTKHFTLKSDVLFNFNKATLKPEGQAALDQLYSQLSNLDPKDGSVVVLGY
TDRIGSDAYNQGLSERRAQSVVDYLISKGIPADKISARGMGESNPVTGNTCDNVKQRAAL
IDCLAPDRRVEIEVKGIKDVVTQPQA

Primary citation

The periplasmic domain of Escherichia coli outer membrane protein A can undergo a localized temperature dependent structural transition. Ishida, H., Garcia-Herrero, A., Vogel, H.J. Biochim Biophys Acta (2014) 1838:3014-3024. DOI 10.1016/j.bbamem.2014.08.008 · PubMed

Other PDB entries of the same protein (UniProt P0A910 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1QJP 1.65 Å, High resolution structure of the outer membrane protein A (OMPA) transmembrane domain
5M2Q 1.7 Å, Structure of cobinamide-bound BtuF mutant W66F, the periplasmic vitamin B12 binding…
9FZC 2.27 Å, Structure of OmpA-short in complex with nanobody Nb01
1BXW 2.5 Å, Outer membrane protein A (OMPA) transmembrane domain
6LYR 3.28 Å, Structure of the BAM complex
6ITC 3.45 Å, Structure of a substrate engaged SecA-SecY protein translocation machine
3JBU 3.64 Å, Mechanisms of Ribosome Stalling by SecM at Multiple Elongation Steps
3NB3 19.0 Å, The host outer membrane proteins OmpA and OmpC are packed at specific sites in the…
1G90 NMR Solution Structure of Outer Membrane Protein A Transmembrane Domain: 10 conformers
2GE4 High-resolution solution structure of outer membrane protein A transmembrane domain
2JMM NMR solution structure of a minimal transmembrane beta-barrel platform protein
9A2M Model of E. coli OmpA by in-cell photo-crosslinking MS and deep learning

Browse structure collections

About this viewer

MolViewer shows 2MQE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.