Solution structure of the Q domain from ACBD3. Determined by solution NMR. Released 20 Jul 2016.
Explore 2N72 in 3D Show helices and sheets RCSB PDB PDBe
2N72 contains 2 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-26 | 23 | |
| α-helix | 31-65 | 35 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Golgi resident protein GCP60 | A | protein | 69 | Homo sapiens | Q9H3P7 (AlphaFold model) |
>2N72_1 Golgi resident protein GCP60 (chains A) MQQKQQIMAALNSQTAVQFQQYAAQQYPGNYEQQQILIRQLQEQHYQQYMQQLYQVQLAQ QQAALQKQQ
Structural insights and in vitro reconstitution of membrane targeting and activation of human PI4KB by the ACBD3 protein. Klima, M., Toth, D.J., Hexnerova, R. et al. Sci Rep (2016) 6:23641-23641. DOI 10.1038/srep23641 · PubMed
Other PDB entries of the same protein (UniProt Q9H3P7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2N72 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.