2N88: Chromodomain 3 (CD3) of cpSRP43

Chromodomain 3 (CD3) of cpSRP43. Determined by solution NMR. Released 9 Dec 2015.

Method: Solution NMR
Organism: Arabidopsis thaliana
Chains: 1
Atoms: 462
Mol. weight: 6.58 kDa
Released: 9 Dec 2015

Explore 2N88 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2N88 contains 2 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	55-62	8	1
β-strand	71-76	6	1
α-helix	79-81	3
β-strand	83-86	4	1
α-helix	92-99	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Signal recognition particle 43 kDa protein, chloroplastic	A	protein	58	Arabidopsis thaliana	O22265 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2N88_1 Signal recognition particle 43 kDa protein, chloroplastic (chains A)
GLEYAVAESVIGKRVGDDGKTIEYLVKWTDMSDATWEPQDNVDSTLVLLYQQQQPMNE

Primary citation

Structural basis for cpSRP43 chromodomain selectivity and dynamics in Alb3 insertase interaction. Horn, A., Hennig, J., Ahmed, Y.L. et al. Nat Commun (2015) 6:8875-8875. DOI 10.1038/ncomms9875 · PubMed

Other PDB entries of the same protein (UniProt O22265 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3DEO 1.5 Å, Structural basis for specific substrate recognition by the chloroplast signal…
3DEP 2.7 Å, Structural basis for specific substrate recognition by the chloroplast signal…
5E4X 2.75 Å, Crystal structure of cpSRP43 chromodomain 3
5E4W 2.8 Å, Crystal structure of cpSRP43 chromodomains 2 and 3 in complex with the Alb3 tail
3UI2 3.18 Å, Crystal structure of the cpSRP54 tail bound to cpSRP43
1X32 Three Dimensional Solution Structure of the Chromo1 domain of cpSRP43
1X3P 3D solution structure of the Chromo-3 domain of cpSRP43
1X3Q 3D Solution Structure of the Chromo-2 Domain of cpSRP43
2HUG 3D Solution Structure of the Chromo-2 Domain of cpSRP43 complexed with cpSRP54 peptide

Browse structure collections

About this viewer

MolViewer shows 2N88 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.