2X0C: R7R8 domains of Talin

Crystal Structure of the R7R8 domains of Talin. Determined by X-ray diffraction at 2.0 Å resolution. Released 7 Jul 2010.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: MUS MUSCULUS
Chains: 1
Atoms: 2,455
Mol. weight: 32.57 kDa
Released: 7 Jul 2010

Explore 2X0C in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2X0C contains 11 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	1354-1373	20
α-helix	1374-1377	4
α-helix	1389-1416	28
α-helix	1419-1450	32
β-strand	1455	1	1
β-strand	1458	1	2
α-helix	1465-1482	18
α-helix	1488-1513	26
α-helix	1519-1546	28
α-helix	1552-1576	25
β-strand	1584	1	2
β-strand	1587	1	1
α-helix	1590-1620	31
α-helix	1627-1654	28
α-helix	1655-1658	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Talin-1	A	protein	309	MUS MUSCULUS	P26039 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2X0C_1 TALIN-1 (chains A)
GIDPFTKHGQKECDNALRQLETVRELLENPVQPINDMSYFGCLDSVMENSKVLGEAMTGI
SQNAKNGNLPEFGDAIATASKALCGFTEAAAQAAYLVGVSDPNSQAGQQGLVEPTQFARA
NQAIQMACQSLGEPGCTQAQVLSAATIVAKHTSALCNSCRLASARTANPTAKRQFVQSAK
EVANSTANLVKTIKALDGDFTEENRAQCRAATAPLLEAVDNLSAFASNPEFSSVPAQISP
EGRAAMEPIVISAKTMLESAGGLIQTARALAVNPRDPPRWSVLAGHSRTVSDSIKKLITS
MRDKAPGQL

Primary citation

Central Region of Talin Has a Unique Fold that Binds Vinculin and Actin. Gingras, A.R., Bate, N., Goult, B.T. et al. J Biol Chem (2010) 285:29577. DOI 10.1074/JBC.M109.095455 · PubMed

Other PDB entries of the same protein (UniProt P26039 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9SR0 1.49 Å, Mouse vinculin head domain 1 (VD1) (residues 2-258) with A50I mutation in complex with…
4W8P 1.5 Å, Crystal structure of RIAM TBS1 in complex with talin R7R8 domains
9DZ5 1.74 Å, Crystal structure of integrin beta-2 tail bound to the FERM-folded talin head domain…
7V1A 1.84 Å, Stapled TBS peptide from RIAM bound to talin R7R8 domains
3DYJ 1.85 Å, Crystal Structure of the R11R12 Domains of Talin
8FSE 1.9 Å, Crystal structure of integrin beta-2 tail bound to the FERM-folded talin head domain
3IVF 1.94 Å, Crystal structure of the talin head FERM domain
3S90 1.97 Å, Human vinculin head domain Vh1 (residues 1-252) in complex with murine talin (VBS33;…
5IC0 1.97 Å, Structural analysis of a talin triple domain module
8FTB 1.97 Å, Crystal structure of integrin beta-2 tail bound to the FERM-folded talin head domain…
4F7G 2.05 Å, Crystal structure of talin autoinhibition complex
1T01 2.06 Å, Vinculin complexed with the VBS1 helix from talin

Browse structure collections

About this viewer

MolViewer shows 2X0C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.