3DEO: Signal recognition particle 43 kDa protein

Structural basis for specific substrate recognition by the chloroplast signal recognition particle protein cpSRP43. Determined by X-ray diffraction at 1.5 Å resolution. Released 12 Aug 2008.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Arabidopsis thaliana
Chains: 1
Atoms: 1,712
Mol. weight: 20.07 kDa
Ligands: MG
Released: 12 Aug 2008

Explore 3DEO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3DEO contains 10 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	86-95	10	1
β-strand	99-106	8	1
α-helix	110-112	3
β-strand	113-116	4	1
α-helix	117-119	3
α-helix	122-137	16
α-helix	141-147	7
α-helix	163-170	8
α-helix	173-181	9
α-helix	197-203	7
α-helix	207-216	10
α-helix	230-239	10
α-helix	246-263	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Signal recognition particle 43 kDa protein	A	protein	183	Arabidopsis thaliana	O22265 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3DEO_1 Signal recognition particle 43 kDa protein (chains A)
EVNKIIGSRTAGEGAMEYLIEWKDGHSPSWVPSSYIAADVVSEYETPWWTAARKADEQAL
SQLLEDRDVDAVDENGRTALLFVAGLGSDKCVRLLAEAGADLDHRDMRGGLTALHMAAGY
VRPEVVEALVELGADIEVEDERGLTALELAREILKTTPKGNPMQFGRRIGLEKVINVLEG
QVF

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1

Primary citation

Structural basis for specific substrate recognition by the chloroplast signal recognition particle protein cpSRP43. Stengel, K.F., Holdermann, I., Cain, P. et al. Science (2008) 321:253-256. DOI 10.1126/science.1158640 · PubMed

Other PDB entries of the same protein (UniProt O22265 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3DEP 2.7 Å, Structural basis for specific substrate recognition by the chloroplast signal…
5E4X 2.75 Å, Crystal structure of cpSRP43 chromodomain 3
5E4W 2.8 Å, Crystal structure of cpSRP43 chromodomains 2 and 3 in complex with the Alb3 tail
3UI2 3.18 Å, Crystal structure of the cpSRP54 tail bound to cpSRP43
1X32 Three Dimensional Solution Structure of the Chromo1 domain of cpSRP43
1X3P 3D solution structure of the Chromo-3 domain of cpSRP43
1X3Q 3D Solution Structure of the Chromo-2 Domain of cpSRP43
2HUG 3D Solution Structure of the Chromo-2 Domain of cpSRP43 complexed with cpSRP54 peptide
2N88 Chromodomain 3 (CD3) of cpSRP43

Browse structure collections

About this viewer

MolViewer shows 3DEO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.