3DYJ: R11R12 Domains of Talin

Crystal Structure of the R11R12 Domains of Talin. Determined by X-ray diffraction at 1.85 Å resolution. Released 27 Jan 2009.

Method: X-ray diffraction
Resolution: 1.85 Å
Organism: Mus musculus
Chains: 2
Atoms: 5,010
Mol. weight: 70.46 kDa
Released: 27 Jan 2009

Explore 3DYJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3DYJ contains 22 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	1976-2000	25
α-helix	2005-2007	3
α-helix	2012-2014	3
α-helix	2016-2036	21
α-helix	2041-2068	28
α-helix	2074-2100	27
α-helix	2109-2161	53
α-helix	2165-2166	2
α-helix	2172-2195	24
α-helix	2198-2223	26
α-helix	2230-2259	30
α-helix	2263-2288	26

Chain B: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	1976-2000	25
α-helix	2012-2037	26
α-helix	2041-2068	28
α-helix	2074-2101	28
α-helix	2109-2160	52
α-helix	2165-2166	2
α-helix	2172-2195	24
α-helix	2198-2223	26
α-helix	2230-2259	30
α-helix	2263-2289	27

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Talin-1	A, B	protein	332	Mus musculus	P26039 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3DYJ_1 TALIN-1 (chains A, B)
GIDPFTGIDPFTGTQACITAASAVSGIIADLDTTIMFATAGTLNREGAETFADHREGILK
TAKVLVEDTKVLVQNAAGSQEKLAQAAQSSVATITRLADVVKLGAASLGAEDPETQVVLI
NAVKDVAKALGDLISATKAAAGKVGDDPAVWQLKNSAKVMVTNVTSLLKTVKAVEDEATK
GTRALEATTEHIRQELAVFCSPEPPAKTSTPEDFIRMTKGITMATAKAVAAGNSCRQEDV
IATANLSRRAIADMLRACKEAAFHPEVAPDVRLRALHYGRECANGYLELLDHVLLTLQKP
NPDLKQQLTGHSKRVAGSVTELIQAAEAMKGT

Primary citation

Structural determinants of integrin binding to the talin rod. Gingras, A.R., Ziegler, W.H., Bobkov, A.A. et al. J Biol Chem (2009) 284:8866-8876. DOI 10.1074/jbc.M805937200 · PubMed

Other PDB entries of the same protein (UniProt P26039 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9SR0 1.49 Å, Mouse vinculin head domain 1 (VD1) (residues 2-258) with A50I mutation in complex with…
4W8P 1.5 Å, Crystal structure of RIAM TBS1 in complex with talin R7R8 domains
9DZ5 1.74 Å, Crystal structure of integrin beta-2 tail bound to the FERM-folded talin head domain…
7V1A 1.84 Å, Stapled TBS peptide from RIAM bound to talin R7R8 domains
8FSE 1.9 Å, Crystal structure of integrin beta-2 tail bound to the FERM-folded talin head domain
3IVF 1.94 Å, Crystal structure of the talin head FERM domain
3S90 1.97 Å, Human vinculin head domain Vh1 (residues 1-252) in complex with murine talin (VBS33;…
5IC0 1.97 Å, Structural analysis of a talin triple domain module
8FTB 1.97 Å, Crystal structure of integrin beta-2 tail bound to the FERM-folded talin head domain…
2X0C 2.0 Å, Crystal Structure of the R7R8 domains of Talin
4F7G 2.05 Å, Crystal structure of talin autoinhibition complex
1T01 2.06 Å, Vinculin complexed with the VBS1 helix from talin

Browse structure collections

About this viewer

MolViewer shows 3DYJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.