3E2U: Zink-knuckle 2 domain of human CLIP-170
Crystal structure of the zink-knuckle 2 domain of human CLIP-170 in complex with CAP-Gly domain of human dynactin-1 (p150-GLUED). Determined by X-ray diffraction at 2.6 Å resolution. Released 19 Aug 2008.
- Method
- X-ray diffraction
- Resolution
- 2.6 Å
- Organism
- Homo sapiens
- Chains
- 8
- Atoms
- 3,085
- Mol. weight
- 60.72 kDa
- Ligands
- ZN
- Released
- 19 Aug 2008
Explore 3E2U in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
3E2U contains 6 α-helices and 40 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 0 helices, 8 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 32-35 | 4 | 1 |
| β-strand | 40-49 | 10 | 1 |
| β-strand | 56-62 | 7 | 1 |
| β-strand | 69 | 1 | 1 |
| β-strand | 72-73 | 2 | 2 |
| β-strand | 76-77 | 2 | 2 |
| β-strand | 86-89 | 4 | 1 |
| β-strand | 94-95 | 2 | 1 |
Chain B: 0 helices, 8 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 32-35 | 4 | 3 |
| β-strand | 40-48 | 9 | 3 |
| β-strand | 57-62 | 6 | 3 |
| β-strand | 69 | 1 | 3 |
| β-strand | 72-73 | 2 | 4 |
| β-strand | 76-77 | 2 | 4 |
| β-strand | 86-89 | 4 | 3 |
| β-strand | 94-96 | 3 | 3 |
Chain C: 1 helix, 8 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 32-35 | 4 | 5 |
| β-strand | 40-48 | 9 | 5 |
| β-strand | 57-62 | 6 | 5 |
| β-strand | 69 | 1 | 5 |
| β-strand | 72-73 | 2 | 6 |
| β-strand | 76-77 | 2 | 6 |
| β-strand | 86-89 | 4 | 5 |
| α-helix | 91-93 | 3 | |
| β-strand | 94-96 | 3 | 5 |
Chain D: 1 helix, 8 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 32-35 | 4 | 7 |
| β-strand | 40-49 | 10 | 7 |
| β-strand | 56-62 | 7 | 7 |
| β-strand | 69 | 1 | 7 |
| β-strand | 72-73 | 2 | 8 |
| β-strand | 76-77 | 2 | 8 |
| β-strand | 86-89 | 4 | 7 |
| α-helix | 91-93 | 3 | |
| β-strand | 94-96 | 3 | 7 |
Chains E, F, G and H: 1 helix, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 1407-1408 | 2 | 9 |
| β-strand | 1413-1414 | 2 | 9 |
| α-helix | 1418-1420 | 3 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Dynactin subunit 1 | A, B, C, D | protein | 97 | Homo sapiens | Q14203 (AlphaFold model) |
| CAP-Gly domain-containing linker protein 1 | E, F, G, H | protein | 42 | Homo sapiens | P30622 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D), FASTA
>3E2U_1 Dynactin subunit 1 (chains A, B, C, D)
GSHMSAEASARPLRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQ
GRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPETPDS
Sequence of entity 2 (E, F, G, H), FASTA
>3E2U_2 CAP-Gly domain-containing linker protein 1 (chains E, F, G, H)
GSMSEDPPHSTHHGSRGEERPYCEICEMFGHWATNCNDDETF
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| ZN | Zinc ion | Zn | 4 |
Primary citation
Structure-function relationship of CAP-Gly domains. Weisbrich, A., Honnappa, S., Jaussi, R. et al. Nat Struct Mol Biol (2007) 14:959-967. DOI 10.1038/nsmb1291 · PubMed
Other PDB entries of the same protein (UniProt Q14203 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 1TXQ 1.8 Å, Crystal structure of the EB1 C-terminal domain complexed with the CAP-Gly domain of…
- 2HQH 1.8 Å, Crystal structure of p150Glued and CLIP-170
- 2HKQ 1.86 Å, Crystal structure of the C-terminal domain of human EB1 in complex with the CAP-Gly…
- 2HKN 1.87 Å, Crystal structure of the CAP-Gly domain of human Dynactin-1 (p150-Glued)
- 2HL5 1.93 Å, Crystal structure of the C-terminal domain of human EB1 in complex with the A49M mutant…
- 2HL3 2.03 Å, Crystal structure of the A49M mutant CAP-Gly domain of human Dynactin-1 (p150-Glued) in…
- 3TQ7 2.3 Å, EB1c/EB3c heterodimer in complex with the CAP-Gly domain of P150glued
- 9B7J 3.49 Å, Cryo-EM structure of human dynactin complex bound to Chlamydia effector Dre1
- 9YND 4.26 Å, Motor domain of human dynein-1 in pre-power stroke bound to dynactin-p150glued-CC1B and…
- 9YNH 5.5 Å, Full-length human cytoplasmic dynein-1 in phi-like state bound to dynactin-p150glued and…
- 9YNE 8.46 Å, Motor domain of human dynein-1 in pre-power stroke bound to dynactin-p150glued-CC1B-ICD…
- 2COY Solution structure of the CAP-Gly domain in human Dynactin 1
Browse structure collections
About this viewer
MolViewer shows 3E2U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.