VHS Domain of human GGA1 complexed with SorLA C-terminal Phosphopeptide. Determined by X-ray diffraction at 2.0 Å resolution. Released 15 Dec 2009.
Explore 3G2T in 3D Show helices and sheets RCSB PDB PDBe
3G2T contains 21 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 10-17 | 8 | |
| α-helix | 27-36 | 10 | |
| α-helix | 43-55 | 13 | |
| α-helix | 60-74 | 15 | |
| α-helix | 79-85 | 7 | |
| α-helix | 88-98 | 11 | |
| α-helix | 104-106 | 3 | |
| α-helix | 109-125 | 17 | |
| α-helix | 130-141 | 12 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 10-17 | 8 | |
| α-helix | 27-36 | 10 | |
| α-helix | 37-39 | 3 | |
| α-helix | 43-55 | 13 | |
| α-helix | 60-76 | 17 | |
| α-helix | 79-85 | 7 | |
| α-helix | 88-98 | 11 | |
| α-helix | 104-106 | 3 | |
| α-helix | 109-125 | 17 | |
| α-helix | 130-141 | 12 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6-12 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 7-12 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| ADP-ribosylation factor-binding protein GGA1 | A, B | protein | 149 | Homo sapiens | Q9UJY5 (AlphaFold model) |
| Phosphorylated C-terminal fragment of Sortilin-related receptor | C, D | protein | 13 | Q92673 (AlphaFold model) |
>3G2T_1 ADP-ribosylation factor-binding protein GGA1 (chains A, B) GSMEPAMEPETLEARINRATNPLNKELDWASINGFCEQLNEDFEGPPLATRLLAHKIQSP QEWEAIQALTVLETCMKSCGKRFHDEVGKFRFLNELIKVVSPKYLGSRTSEKVKNKILEL LYSWTVGLPEEVKIAEAYQMLKKQGIVKS
>3G2T_2 Phosphorylated C-terminal fragment of Sortilin-related receptor (chains C, D) ITGFSDDVPMVIA
GGA autoinhibition revisited. Cramer, J.F., Gustafsen, C., Behrens, M.A. et al. Traffic (2010) 11:259-273. DOI 10.1111/j.1600-0854.2009.01017.x · PubMed
Other PDB entries of the same protein (UniProt Q9UJY5 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3G2T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.