3K75: Reduced XRCC1

X-ray crystal structure of reduced XRCC1 bound to DNA pol beta catalytic domain. Determined by X-ray diffraction at 2.95 Å resolution. Released 28 Apr 2010.

Method: X-ray diffraction
Resolution: 2.95 Å
Organisms: Homo sapiens, Rattus norvegicus
Chains: 4
Atoms: 6,363
Mol. weight: 100.79 kDa
Released: 28 Apr 2010

Explore 3K75 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3K75 contains 39 α-helices and 48 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 5 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	1
α-helix	4-5	2
β-strand	6-12	7	2
α-helix	21-24	4
β-strand	33-34	2	1
β-strand	38	1	3
β-strand	40	1	3
β-strand	42-54	13	2
β-strand	57-64	8	1
β-strand	67-73	7	2
β-strand	85-92	8	2
α-helix	96-100	5
β-strand	108-111	4	1
α-helix	113-115	3
α-helix	118-122	5
β-strand	124-133	10	2
β-strand	143-150	8	1

Chain C: 2 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	4
β-strand	8-12	5	5
β-strand	33-34	2	6
β-strand	42-48	7	5
β-strand	53	1	7
β-strand	58-62	5	6
β-strand	67-73	7	5
β-strand	85-92	8	5
α-helix	96-101	6
β-strand	108-111	4	6
α-helix	113-115	3
β-strand	116	1	5
β-strand	125	1	7
β-strand	127-133	7	5
β-strand	143-149	7	6
β-strand	150	1	4

Chain D: 17 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	93-100	8
α-helix	108-116	9
α-helix	122-125	4
α-helix	129-131	3
α-helix	134-141	8
α-helix	143-147	5
β-strand	150-151	2	8
α-helix	152-169	18
β-strand	174-177	4	9
α-helix	179-182	4
β-strand	187-188	2	8
β-strand	191-196	6	9
α-helix	208-220	13
β-strand	224-230	7	9
β-strand	234-239	6	9
α-helix	248-252	5
β-strand	253-259	7	9
α-helix	262-264	3
α-helix	265-273	9
α-helix	276-288	13
β-strand	291-293	3	10
β-strand	298-300	3	10
β-strand	301	1	11
β-strand	307	1	11
α-helix	309-312	4
α-helix	316-323	8
α-helix	326-329	4
α-helix	330-332	3

Chain E: 15 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	94-101	8
α-helix	108-116	9
α-helix	122-127	6
α-helix	129-131	3
α-helix	134-141	8
β-strand	150-151	2	12
α-helix	152-169	18
β-strand	174-177	4	13
α-helix	180-183	4
β-strand	187-188	2	12
β-strand	191-196	6	13
α-helix	208-220	13
β-strand	224-230	7	13
β-strand	234-240	7	13
α-helix	249-251	3
β-strand	252-259	8	13
α-helix	262-264	3
α-helix	265-273	9
α-helix	276-288	13
β-strand	291-294	4	14
β-strand	297-300	4	14
β-strand	301	1	15
β-strand	307	1	15
α-helix	309-312	4
α-helix	316-322	7
α-helix	330-332	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA repair protein XRCC1	B, C	protein	189	Homo sapiens	P18887 (AlphaFold model)
DNA polymerase beta	D, E	protein	252	Rattus norvegicus	P06766 (AlphaFold model)

Sequence of entity 1 (B, C), FASTA

>3K75_1 DNA repair protein XRCC1 (chains B, C)
MPEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDI
GNDGSAFVEVLVGSSAGGAGEQDYEVLLVTSSFMSPSESRSGSNPNRVRMFGPDKLVRAA
AEKRWDRVKIVCSQPYSKDSPFGLSFVRFHSPPDKDEAEAPSQKVTVTKLGQFRVKEEDE
SANHHHHHH

Sequence of entity 2 (D, E), FASTA

>3K75_2 DNA polymerase beta (chains D, E)
MDDTSSSINFLTRVTGIGPSAARKLVDEGIKTLEDLRKNEDKLNHHQRIGLKYFEDFEKR
IPREEMLQMQDIVLNEVKKLDPEYIATVCGSFRRGAESSGDMDVLLTHPNFTSESSKQPK
LLHRVVEQLQKVRFITDTLSKGETKFMGVCQLPSENDENEYPHRRIDIRLIPKDQYYCGV
LYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEQDIFDYIQWRYRE
PKDRSEHHHHHH

Primary citation

Oxidation state of the XRCC1 N-terminal domain regulates DNA polymerase beta binding affinity. Cuneo, M.J., London, R.E. Proc Natl Acad Sci U S A (2010) 107:6805-6810. DOI 10.1073/pnas.0914077107 · PubMed

Other PDB entries of the same protein (UniProt P18887 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2W3O 1.85 Å, Crystal structure of the human PNKP FHA domain in complex with an XRCC1-derived…
5W7X 2.0 Å, Crystal Structure of FHA domain of human APLF in complex with XRCC1 bisphospho peptide
5W7Y 2.1 Å, Crystal Structure of FHA domain of human APLF in complex with XRCC1 monophosphorylated…
5E6Q 2.31 Å, Importin alpha binding to XRCC1 NLS peptide
3LQC 2.35 Å, X-ray crystal structure of oxidized XRCC1 bound to DNA pol beta Palm thumb domain
6WH1 2.4 Å, Structure of the complex of human DNA ligase III-alpha and XRCC1 BRCT domains
6WH2 2.41 Å, Structure of the C-terminal BRCT domain of human XRCC1
3K77 2.6 Å, X-ray crystal structure of XRCC1
1CDZ 3.2 Å, Brct domain from DNA-repair protein XRCC1
1XNA NMR solution structure of the single-strand break repair protein XRCC1-N-terminal domain
1XNT NMR solution structure of the single-strand break repair protein XRCC1-N-terminal domain
2D8M Solution structure of the first BRCT domain of DNA-repair protein XRCC1

Browse structure collections

About this viewer

MolViewer shows 3K75 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.