3L5H: Interleukin-6 receptor subunit beta

Crystal structure of the full ectodomain of human gp130: New insights into the molecular assembly of receptor complexes. Determined by X-ray diffraction at 3.6 Å resolution. Released 19 May 2010.

Method: X-ray diffraction
Resolution: 3.6 Å
Organism: Homo sapiens
Chains: 1
Atoms: 4,701
Mol. weight: 71.03 kDa
Released: 19 May 2010

Explore 3L5H in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3L5H contains 7 α-helices and 62 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 62 β-strands

Element	Residues	Length	Sheet
β-strand	46	1	1
β-strand	51	1	1
α-helix	54-56	3
β-strand	58	1	2
β-strand	66	1	2
β-strand	108-115	8	3
β-strand	116	1	4
β-strand	118	1	4
β-strand	120-125	6	3
β-strand	134-138	5	5
β-strand	141	1	6
β-strand	146	1	6
β-strand	150-151	2	5
β-strand	153	1	7
β-strand	156	1	7
β-strand	161	1	3
β-strand	172-174	3	8
β-strand	176-180	5	5
β-strand	185	1	5
β-strand	190-192	3	8
α-helix	194-196	3
β-strand	198-199	2	3
β-strand	207-209	3	9
β-strand	218-221	4	9
α-helix	226-229	4
β-strand	233-241	9	10
β-strand	248	1	10
β-strand	261-264	4	9
α-helix	267-268	2
β-strand	273-281	9	10
α-helix	290-292	3
β-strand	295	1	10
β-strand	310-313	4	11
β-strand	320	1	12
β-strand	322	1	12
β-strand	325-329	5	11
α-helix	331-333	3
β-strand	343-348	6	13
β-strand	357	1	13
β-strand	366-367	2	11
β-strand	376-381	6	13
β-strand	382	1	14
β-strand	385	1	14
β-strand	409-412	4	15
β-strand	417-420	4	15
β-strand	431	1	16
β-strand	434-438	5	17
β-strand	446-448	3	17
β-strand	451	1	16
β-strand	457-459	3	15
β-strand	469-474	6	17
β-strand	476	1	16
β-strand	477-478	2	18
β-strand	481-482	2	18
β-strand	486-491	6	17
β-strand	505-506	2	19
β-strand	513	1	20
β-strand	514-515	2	19
β-strand	516	1	21
α-helix	522-525	4
β-strand	529-534	6	22
β-strand	537	1	23
β-strand	546-548	3	22
β-strand	554	1	21
β-strand	557	1	20
β-strand	566-567	2	23
β-strand	570-574	5	22
β-strand	577-580	4	22
β-strand	585-586	2	23

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-6 receptor subunit beta	A	protein	589	Homo sapiens	P40189 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3L5H_1 Interleukin-6 receptor subunit beta (chains A)
LLDPCGYISPESPVVQLHSNFTAVCVLKEKCMDYFHVNANYIVWKTNHFTIPKEQYTIIN
RTASSVTFTDIASLNIQLTCNILTFGQLEQNVYGITIISGLPPEKPKNLSCIVNEGKKMR
CEWDGGRETHLETNFTLKSEWATHKFADCKAKRDTPTSCTVDYSTVYFVNIEVWVEAENA
LGKVTSDHINFDPVYKVKPNPPHNLSVINSEELSSILKLTWTNPSIKSVIILKYNIQYRT
KDASTWSQIPPEDTASTRSSFTVQDLKPFTEYVFRIRCMKEDGKGYWSDWSEEASGITYE
DRPSKAPSFWYKIDPSHTQGYRTVQLVWKTLPPFEANGKILDYEVTLTRWKSHLQNYTVN
ATKLTVNLTNDRYLATLTVRNLVGKSDAAVLTIPACDFQATHPVMDLKAFPKDNMLWVEW
TTPRESVKKYILEWCVLSDKAPCITDWQQEDGTVHRTYLRGNLAESKCYLITVTPVYADG
PGSPESIKAYLKQAPPSKGPTVRTKKVGKNEAVLEWDQLPVDVQNGFIRNYTIFYRTIIG
NETAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEGGKDGPEFTFTTPK

Primary citation

Crystal structure of the entire ectodomain of gp130: insights into the molecular assembly of the tall cytokine receptor complexes. Xu, Y., Kershaw, N.J., Luo, C.S. et al. J Biol Chem (2010) 285:21214-21218. DOI 10.1074/jbc.C110.129502 · PubMed

Other PDB entries of the same protein (UniProt P40189 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3L5I 1.9 Å, Crystal structure of FnIII domains of human GP130 (Domains 4-6)
1BQU 2.0 Å, Cytokyne-binding region of GP130
1I1R 2.4 Å, Crystal structure of a cytokine/receptor complex
1PVH 2.5 Å, Crystal structure of leukemia inhibitory factor in complex with gp130
8D74 3.03 Å, Cryo-EM structure of human CNTF signaling complex: model containing the interaction core…
3L5J 3.04 Å, Crystal structure of FnIII domains of human GP130 (Domains 4-6)
8D82 3.22 Å, Cryo-EM structure of human IL-6 signaling complex in detergent: model containing full…
8UPA 3.3 Å, Structure of gp130 in complex with a de novo designed IL-6 mimetic
7U7N 3.47 Å, IL-27 quaternary receptor signaling complex
8DPS 3.47 Å, The structure of the interleukin 11 signalling complex, truncated gp130
8D6A 3.54 Å, Cryo-EM structure of human LIF signaling complex: model containing the interaction core…
8V2A 3.59 Å, Cryo-EM structure of human type I OSM receptor complex: model for assembly core region

Browse structure collections

About this viewer

MolViewer shows 3L5H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.