3MXN: RMI core complex

Crystal structure of the RMI core complex. Determined by X-ray diffraction at 1.55 Å resolution. Released 15 Sept 2010.

Method: X-ray diffraction
Resolution: 1.55 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,523
Mol. weight: 33.69 kDa
Ligands: BEN
Released: 15 Sept 2010

Explore 3MXN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3MXN contains 11 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	480-482	3
α-helix	483-487	5
α-helix	494-499	6
β-strand	506-517	12	1
β-strand	522	1	2
α-helix	524-526	3
β-strand	529	1	2
β-strand	531-535	5	1
β-strand	540-545	6	1
α-helix	547-554	8
α-helix	558-564	7
α-helix	568-587	20
β-strand	589-597	9	1
β-strand	602-609	8	1
α-helix	613-622	10

Chain B: 3 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	23-24	2	3
α-helix	27-33	7
β-strand	34-35	2	4
β-strand	42-43	2	4
β-strand	53-54	2	4
β-strand	57-68	12	3
β-strand	71-76	6	3
β-strand	79-84	6	3
α-helix	86-88	3
β-strand	101-110	10	3
β-strand	116-124	9	3
α-helix	129-143	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RecQ-mediated genome instability protein 1	A	protein	157	Homo sapiens	Q9H9A7 (AlphaFold model)
RecQ-mediated genome instability protein 2	B	protein	150	Homo sapiens	Q96E14 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3MXN_1 RecQ-mediated genome instability protein 1 (chains A)
GSHMSSENSINLSIAMDLYSPPFVYLSVLMASKPKEVTTVKVKAFIVTLTGNLSSSGGIW
SITAKVSDGTAYLDVDFVDEILTSLIGFSVPEMKQSKKDPLQYQKFLEGLQKCQRDLIDL
CCLMTISFNPSLSKAMVLALQDVNMEHLENLKKRLNK

Sequence of entity 2 (B), FASTA

>3MXN_2 RecQ-mediated genome instability protein 2 (chains B)
GSHMAAAADSFSGGPAGVRLPRSPPLKVLAEQLRRDAEGGPGAWRLSRAAAGRGPLDLAA
VWMQGRVVMADRGEARLRDPSGDFSVRGLERVPRGRPCLVPGKYVMVMGVVQACSPEPCL
QAVKMTDLSDNPIHESMWELEVEDLHRNIP

Ligands and cofactors

ID	Name	Formula	Copies
BEN	Benzamidine	C7 H8 N2	1

Primary citation

Structure and cellular roles of the RMI core complex from the bloom syndrome dissolvasome. Hoadley, K.A., Xu, D., Xue, Y. et al. Structure (2010) 18:1149-1158. DOI 10.1016/j.str.2010.06.009 · PubMed

Other PDB entries of the same protein (UniProt Q9H9A7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7XUV 1.6 Å, Crystal structure of RPA70N-RMI1 fusion
3NBH 2.0 Å, Crystal structure of human RMI1C-RMI2 complex
3NBI 2.0 Å, Crystal structure of human RMI1 N-terminus
9PFD 2.01 Å, RMI1-RMI2 bound to synthetic peptide P4Ser
9DHK 2.35 Å, RMI1-RMI2 bound to cyclic peptide L3
9DI4 2.7 Å, RMI1-RMI2 bound to cyclic peptide L4
4CGY 2.85 Å, Crystal structure of the human topoisomerase III alpha-RMI1 complex
4CHT 3.25 Å, Crystal structure of the human topoisomerase III alpha-RMI1 complex with bound calcium ion
4DAY 3.3 Å, Crystal structure of the RMI core complex with MM2 peptide from FANCM

Browse structure collections

About this viewer

MolViewer shows 3MXN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.