3NBI: Human RMI1 N-terminus

Crystal structure of human RMI1 N-terminus. Determined by X-ray diffraction at 2.0 Å resolution. Released 22 Sept 2010.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,611
Mol. weight: 24.5 kDa
Released: 22 Sept 2010

Explore 3NBI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3NBI contains 10 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	3-18	16
α-helix	24-38	15
α-helix	45-57	13
α-helix	61-64	4
α-helix	70	1
β-strand	78-94	17	1
α-helix	96-108	13
α-helix	129-133	5
β-strand	135-140	6	1
β-strand	145-150	6	1
α-helix	161-162	2
β-strand	166-176	11	1
β-strand	179-182	4	1
α-helix	184-186	3
β-strand	187-191	5	1
α-helix	195-201	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RecQ-mediated genome instability protein 1	A	protein	216	Homo sapiens	Q9H9A7 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3NBI_1 RecQ-mediated genome instability protein 1 (chains A)
SGGRNVTSIALRAETWLLAAWHVKVPPMWLEACINWIQEENNNVNLSQAQMNKQVFEQWL
LTDLRDLEHPLLPDGILEIPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKNTTNDLVT
AEAQVTPKPWEAKPSRMLMLQLTDGIVQIQGMEYQPIPILHSDLPPGTKILIYGNISFRL
GVLLLKPENVKVLGGEVDALLEEYAQEKVLARLIGE

Primary citation

Crystal Structures of RMI1 and RMI2, Two OB-Fold Regulatory Subunits of the BLM Complex. Wang, F., Yang, Y., Singh, T.R. et al. Structure (2010) 18:1159-1170. DOI 10.1016/j.str.2010.06.008 · PubMed

Other PDB entries of the same protein (UniProt Q9H9A7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3MXN 1.55 Å, Crystal structure of the RMI core complex
7XUV 1.6 Å, Crystal structure of RPA70N-RMI1 fusion
3NBH 2.0 Å, Crystal structure of human RMI1C-RMI2 complex
9PFD 2.01 Å, RMI1-RMI2 bound to synthetic peptide P4Ser
9DHK 2.35 Å, RMI1-RMI2 bound to cyclic peptide L3
9DI4 2.7 Å, RMI1-RMI2 bound to cyclic peptide L4
4CGY 2.85 Å, Crystal structure of the human topoisomerase III alpha-RMI1 complex
4CHT 3.25 Å, Crystal structure of the human topoisomerase III alpha-RMI1 complex with bound calcium ion
4DAY 3.3 Å, Crystal structure of the RMI core complex with MM2 peptide from FANCM

Browse structure collections

About this viewer

MolViewer shows 3NBI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.