9DI4: RMI1-RMI2

RMI1-RMI2 bound to cyclic peptide L4. Determined by X-ray diffraction at 2.7 Å resolution. Released 2 Jul 2025.

Method: X-ray diffraction
Resolution: 2.7 Å
Organisms: Homo sapiens, synthetic construct
Chains: 3
Atoms: 2,321
Mol. weight: 34.6 kDa
Ligands: ZN
Released: 2 Jul 2025

Explore 9DI4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9DI4 contains 9 α-helices and 19 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	494-499	6
β-strand	506-517	12	1
β-strand	522	1	2
α-helix	524-526	3
β-strand	529	1	2
β-strand	531-535	5	1
β-strand	540-545	6	1
α-helix	547-554	8
α-helix	558-564	7
α-helix	568-587	20
β-strand	589-597	9	1
β-strand	602-609	8	1
α-helix	613-622	10

Chain B: 3 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	16	1	1
β-strand	23-24	2	3
α-helix	27-33	7
β-strand	34-35	2	4
β-strand	42-43	2	4
α-helix	50-52	3
β-strand	53-54	2	4
β-strand	57-68	12	3
β-strand	71-76	6	3
β-strand	79-84	6	3
β-strand	101-110	10	3
β-strand	116-124	9	3
α-helix	130-144	15

Chain C: 0 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	2-4	3	1
β-strand	8-10	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RecQ-mediated genome instability protein 1	A	protein	152	Homo sapiens	Q9H9A7 (AlphaFold model)
RecQ-mediated genome instability protein 2	B	protein	147	Homo sapiens	Q96E14 (AlphaFold model)
L4 cyclic peptide	C	protein	15	synthetic construct

Sequence of entity 1 (A), FASTA

>9DI4_1 RecQ-mediated genome instability protein 1 (chains A)
MENSINLSIAMDLYSPPFVYLSVLMASKPKEVTTVKVKAFIVTLTGNLSSSGGIWSITAK
VSDGTAYLDVDFVDEILTSLIGFSVPEMKQSKKDPLQYQKFLEGLQKCQRDLIDLCCLMT
ISFNPSLSKAMVLALQDVNMEHLENLKKRLNK

Sequence of entity 2 (B), FASTA

>9DI4_2 RecQ-mediated genome instability protein 2 (chains B)
MAAAADSFSGGPAGVRLPRSPPLKVLAEQLRRDAEGGPGAWRLSRAAAGRGPLDLAAVWM
QGRVVMADRGEARLRDPSGDFSVRGLERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAV
KMTDLSDNPIHESMWELEVEDLHRNIP

Sequence of entity 3 (C), FASTA

>9DI4_3 L4 cyclic peptide (chains C)
XYSILFDKYYSIPCX

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Potent Cyclic Peptide Inhibitors Disrupt the FANCM-RMI Interaction. Alcock, L.J., Gao, T., Bythell-Douglas, R. et al. J Med Chem (2025) 68:12615-12625. DOI 10.1021/acs.jmedchem.5c00365 · PubMed

Other PDB entries of the same protein (UniProt Q9H9A7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3MXN 1.55 Å, Crystal structure of the RMI core complex
7XUV 1.6 Å, Crystal structure of RPA70N-RMI1 fusion
3NBH 2.0 Å, Crystal structure of human RMI1C-RMI2 complex
3NBI 2.0 Å, Crystal structure of human RMI1 N-terminus
9PFD 2.01 Å, RMI1-RMI2 bound to synthetic peptide P4Ser
9DHK 2.35 Å, RMI1-RMI2 bound to cyclic peptide L3
4CGY 2.85 Å, Crystal structure of the human topoisomerase III alpha-RMI1 complex
4CHT 3.25 Å, Crystal structure of the human topoisomerase III alpha-RMI1 complex with bound calcium ion
4DAY 3.3 Å, Crystal structure of the RMI core complex with MM2 peptide from FANCM

Browse structure collections

About this viewer

MolViewer shows 9DI4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.