9PFD: RMI1-RMI2

RMI1-RMI2 bound to synthetic peptide P4Ser. Determined by X-ray diffraction at 2.01 Å resolution. Released 4 Feb 2026.

Method: X-ray diffraction
Resolution: 2.01 Å
Organisms: Homo sapiens, synthetic construct
Chains: 3
Atoms: 2,435
Mol. weight: 34.5 kDa
Released: 4 Feb 2026

Explore 9PFD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9PFD contains 13 α-helices and 19 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	492	1	1
α-helix	494-499	6
β-strand	506-517	12	1
β-strand	522	1	2
α-helix	524-526	3
β-strand	529	1	2
β-strand	531-535	5	1
β-strand	540-545	6	1
α-helix	547-554	8
α-helix	558-564	7
α-helix	568-587	20
β-strand	589-597	9	1
α-helix	598-600	3
β-strand	602-609	8	1
α-helix	613-622	10

Chain B: 5 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	12-14	3
β-strand	16	1	3
β-strand	23-24	2	4
α-helix	27-33	7
β-strand	34-35	2	5
β-strand	42-45	4	5
α-helix	46-48	3
β-strand	50-54	5	5
β-strand	58-68	11	4
β-strand	71-76	6	4
β-strand	79-84	6	4
α-helix	86-88	3
β-strand	101-110	10	4
β-strand	116-124	9	4
α-helix	130-144	15

Chain C: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	5	1	3
α-helix	10-13	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RecQ-mediated genome instability protein 1	A	protein	152	Homo sapiens	Q9H9A7 (AlphaFold model)
RecQ-mediated genome instability protein 2	B	protein	147	Homo sapiens	Q96E14 (AlphaFold model)
P4Ser peptide	C	protein	15	synthetic construct

Sequence of entity 1 (A), FASTA

>9PFD_1 RecQ-mediated genome instability protein 1 (chains A)
MENSINLSIAMDLYSPPFVYLSVLMASKPKEVTTVKVKAFIVTLTGNLSSSGGIWSITAK
VSDGTAYLDVDFVDEILTSLIGFSVPEMKQSKKDPLQYQKFLEGLQKCQRDLIDLCCLMT
ISFNPSLSKAMVLALQDVNMEHLENLKKRLNK

Sequence of entity 2 (B), FASTA

>9PFD_2 RecQ-mediated genome instability protein 2 (chains B)
MAAAADSFSGGPAGVRLPRSPPLKVLAEQLRRDAEGGPGAWRLSRAAAGRGPLDLAAVWM
QGRVVMADRGEARLRDPSGDFSVRGLERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAV
KMTDLSDNPIHESMWELEVEDLHRNIP

Sequence of entity 3 (C), FASTA

>9PFD_3 P4Ser peptide (chains C)
SSHFKLYWPPFLGSX

Primary citation

Potent Cyclic Peptide Inhibitors Disrupt the FANCM-RMI Interaction. Alcock, L.J., Gao, T., Bythell-Douglas, R. et al. J Med Chem (2025) 68:12615-12625. DOI 10.1021/acs.jmedchem.5c00365 · PubMed

Other PDB entries of the same protein (UniProt Q9H9A7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3MXN 1.55 Å, Crystal structure of the RMI core complex
7XUV 1.6 Å, Crystal structure of RPA70N-RMI1 fusion
3NBH 2.0 Å, Crystal structure of human RMI1C-RMI2 complex
3NBI 2.0 Å, Crystal structure of human RMI1 N-terminus
9DHK 2.35 Å, RMI1-RMI2 bound to cyclic peptide L3
9DI4 2.7 Å, RMI1-RMI2 bound to cyclic peptide L4
4CGY 2.85 Å, Crystal structure of the human topoisomerase III alpha-RMI1 complex
4CHT 3.25 Å, Crystal structure of the human topoisomerase III alpha-RMI1 complex with bound calcium ion
4DAY 3.3 Å, Crystal structure of the RMI core complex with MM2 peptide from FANCM

Browse structure collections

About this viewer

MolViewer shows 9PFD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.