3NBH: Human RMI1C-RMI2 complex

Crystal structure of human RMI1C-RMI2 complex. Determined by X-ray diffraction at 2.0 Å resolution. Released 22 Sept 2010.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,546
Mol. weight: 33.62 kDa
Released: 22 Sept 2010

Explore 3NBH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3NBH contains 13 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	480-482	3
α-helix	483-487	5
α-helix	494-499	6
β-strand	506-517	12	1
α-helix	520-521	2
β-strand	522	1	1
α-helix	524-526	3
β-strand	529-535	7	1
β-strand	540-546	7	1
α-helix	548-554	7
α-helix	558-564	7
α-helix	568-587	20
β-strand	589-597	9	1
β-strand	602-609	8	1
α-helix	613-624	12

Chain B: 4 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	23-24	2	2
α-helix	27-28	2
α-helix	29-33	5
β-strand	34-37	4	3
β-strand	40-43	4	3
β-strand	53-55	3	3
β-strand	57-68	12	2
β-strand	71-76	6	2
β-strand	79-84	6	2
α-helix	86-88	3
β-strand	101-110	10	2
β-strand	116-124	9	2
α-helix	129-144	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RecQ-mediated genome instability protein 1	A	protein	155	Homo sapiens	Q9H9A7 (AlphaFold model)
RecQ-mediated genome instability protein 2	B	protein	147	Homo sapiens	Q96E14 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3NBH_1 RecQ-mediated genome instability protein 1 (chains A)
SGGRENSINLSIAMDLYSPPFVYLSVLMASKPKEVTTVKVKAFIVTLTGNLSSSGGIWSI
TAKVSDGTAYLDVDFVDEILTSLIGFSVPEMKQSKKDPLQYQKFLEGLQKCQRDLIDLCC
LMTISFNPSLSKAMVLALQDVNMEHLENLKKRLNK

Sequence of entity 2 (B), FASTA

>3NBH_2 RecQ-mediated genome instability protein 2 (chains B)
GPLGSDSFSGGPAGVRLPRSPPLKVLAEQLRRDAEGGPGAWRLSRAAAGRGPLDLAAVWM
QGRVVMADRGEARLRDPSGDFSVRGLERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAV
KMTDLSDNPIHESMWELEVEDLHRNIP

Primary citation

Crystal Structures of RMI1 and RMI2, Two OB-Fold Regulatory Subunits of the BLM Complex. Wang, F., Yang, Y., Singh, T.R. et al. Structure (2010) 18:1159-1170. DOI 10.1016/j.str.2010.06.008 · PubMed

Other PDB entries of the same protein (UniProt Q9H9A7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3MXN 1.55 Å, Crystal structure of the RMI core complex
7XUV 1.6 Å, Crystal structure of RPA70N-RMI1 fusion
3NBI 2.0 Å, Crystal structure of human RMI1 N-terminus
9PFD 2.01 Å, RMI1-RMI2 bound to synthetic peptide P4Ser
9DHK 2.35 Å, RMI1-RMI2 bound to cyclic peptide L3
9DI4 2.7 Å, RMI1-RMI2 bound to cyclic peptide L4
4CGY 2.85 Å, Crystal structure of the human topoisomerase III alpha-RMI1 complex
4CHT 3.25 Å, Crystal structure of the human topoisomerase III alpha-RMI1 complex with bound calcium ion
4DAY 3.3 Å, Crystal structure of the RMI core complex with MM2 peptide from FANCM

Browse structure collections

About this viewer

MolViewer shows 3NBH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.