3VTW: T7-tagged Optineurin LIR-fused human LC3B_2-119

Crystal structure of T7-tagged Optineurin LIR-fused human LC3B_2-119. Determined by X-ray diffraction at 2.52 Å resolution. Released 26 Jun 2013.

Method: X-ray diffraction
Resolution: 2.52 Å
Organism: Homo sapiens
Chains: 3
Atoms: 3,207
Mol. weight: 51.91 kDa
Released: 26 Jun 2013

Explore 3VTW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3VTW contains 21 α-helices and 21 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	17-21	5
α-helix	22-25	4
α-helix	28-41	14
β-strand	45-52	8	1
α-helix	60-62	3
β-strand	66-70	5	1
β-strand	74	1	2
α-helix	75-85	11
β-strand	95-98	4	1
β-strand	101-102	2	1
β-strand	109	1	2
α-helix	110-117	8
α-helix	123	1
β-strand	124-129	6	1

Chain B: 7 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	18-21	4
α-helix	22-25	4
α-helix	28-41	14
β-strand	45-52	8	3
α-helix	60-62	3
β-strand	66-70	5	3
β-strand	74	1	4
α-helix	75-86	12
β-strand	95-98	4	3
β-strand	101-102	2	3
β-strand	109	1	4
α-helix	110-117	8
α-helix	123	1
β-strand	124-129	6	3

Chain C: 7 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	18-21	4
α-helix	22-25	4
α-helix	28-41	14
β-strand	45-52	8	5
α-helix	60-62	3
β-strand	66-70	5	5
β-strand	74	1	6
α-helix	75-85	11
β-strand	95-98	4	5
β-strand	101	1	5
β-strand	109	1	6
α-helix	110-117	8
α-helix	123	1
β-strand	124-129	6	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Optineurin, microtubule-associated proteins 1A/1B light chain 3B	A, B, C	protein	149	Homo sapiens	Q96CV9 (AlphaFold model), Q9GZQ8 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>3VTW_1 Optineurin, microtubule-associated proteins 1A/1B light chain 3B (chains A, B, C)
GSHMASMTGGQQMGRGSEEGEEEDEFVEIGGPSEKTFKQRRTFEQRVEDVRLIREQHPTK
IPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVS
VSTPISEVYESEKDEDGFLYMVYASQETF

Primary citation

Structural basis for phosphorylation-triggered autophagic clearance of Salmonella. Rogov, V.V., Suzuki, H., Fiskin, E. et al. Biochem J (2013) 454:459-466. DOI 10.1042/BJ20121907 · PubMed

Other PDB entries of the same protein (UniProt Q96CV9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3VTV 1.7 Å, Crystal structure of Optineurin LIR-fused human LC3B_2-119
9B0B 1.7 Å, Structure of Optineurin bound to HOIP NZF1 domain
9B12 1.81 Å, Structure of Optineurin bound to HOIP NZF1 domain and M1-linked diubiquitin, crystal…
9M0O 1.83 Å, Crystal structure of OPTN 138-170 in complex with GTP-bound RAB8A1-176 (Q67L)
9IKQ 1.93 Å, Crystal structure of OPTN LZD in complex with GTP-bound Rab8a(Q67L)
7CZM 2.0 Å, Crystal structure of FIP200 Claw/p-OPtineurin LIR complex
5EOF 2.05 Å, Crystal structure of OPTN NTD and TBK1 CTD complex
9B0Z 2.41 Å, Structure of Optineurin bound to HOIP NZF1 domain and M1-linked diubiquitin, crystal…
5EOA 2.5 Å, Crystal structure of OPTN E50K mutant and TBK1 complex
5B83 2.69 Å, Crystal structure of Optineurin UBAN in complex with linear ubiquitin
2LO4 NMR Solution Structure of Optineurin Zinc-finger Domain
2LUE LC3B OPTN-LIR Ptot complex structure

Browse structure collections

About this viewer

MolViewer shows 3VTW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.