4EHP: Human vinculin head domain

Crystal Structure of human vinculin head domain (residues 1-252) in complex with alpha-catenin (residues 277-382). Determined by X-ray diffraction at 2.66 Å resolution. Released 18 Apr 2012.

Method: X-ray diffraction
Resolution: 2.66 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,796
Mol. weight: 41.35 kDa
Released: 18 Apr 2012

Explore 4EHP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4EHP contains 16 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	6	1	1
α-helix	7-28	22
α-helix	35-39	5
α-helix	41-64	24
α-helix	68-73	6
α-helix	75-97	23
α-helix	103-145	43
α-helix	154-162	9
α-helix	165-181	17
β-strand	182	1	1
α-helix	185-217	33
α-helix	224-248	25

Chain B: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	293-299	7
α-helix	305-316	12
α-helix	325-327	3
α-helix	328-352	25
α-helix	353-355	3
α-helix	363-380	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Vinculin	A	protein	253	Homo sapiens	P18206 (AlphaFold model)
Catenin alpha-1	B	protein	111	Homo sapiens	P35221 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4EHP_1 Vinculin (chains A)
MMPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGK
ETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGT
SDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQ
QELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSA
EINEIIRVLQLTS

Sequence of entity 2 (B), FASTA

>4EHP_2 Catenin alpha-1 (chains B)
GPLGSELAYALNNFDKQIIVDPLSFSEERFRPSLEERLESIISGAALMADSSCTRDDRRE
RIVAECNAVRQALQDLLSEYMGNAGRKERSDALNSAIDKMTKKTRDLRRQL

Primary citation

alpha-Catenin unfurls upon binding to vinculin. Rangarajan, E.S., Izard, T. J Biol Chem (2012) 287:18492-18499. DOI 10.1074/jbc.M112.351023 · PubMed

Other PDB entries of the same protein (UniProt P18206 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4LN2 1.0 Å, The second SH3 domain from CAP/Ponsin in complex with proline rich peptide from Vinculin
4LNP 1.41 Å, The first SH3 domain from CAP/Ponsin in complex with proline rich peptide from Vinculin
3RF3 1.61 Å, Shigella IpaA-VBS3 in complex with human vinculin
1YDI 1.8 Å, Human Vinculin Head Domain (VH1, 1-258) in Complex with Human Alpha-Actinin's…
3S90 1.97 Å, Human vinculin head domain Vh1 (residues 1-252) in complex with murine talin (VBS33;…
3TJ5 1.99 Å, human vinculin head domain (Vh1, residues 1-258) in complex with the vinculin binding…
3MYI 2.2 Å, Human metavinculin tail domain
4DJ9 2.25 Å, Human vinculin head domain Vh1 (residues 1-258) in complex with the talin vinculin…
1RKE 2.35 Å, Human vinculin head (1-258) in complex with human vinculin tail (879-1066)
1SYQ 2.42 Å, Human vinculin head domain VH1, residues 1-258, in complex with human talin's vinculin…
5L0I 2.45 Å, Human metavinculin MVt R975W cardiomyopathy-associated mutant (residues 959-1134)
3VF0 2.54 Å, Raver1 in complex with metavinculin L954 deletion mutant

Browse structure collections

About this viewer

MolViewer shows 4EHP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.