4QXF: Human LGR4 and Rspo1

crystal structure of human LGR4 and Rspo1. Determined by X-ray diffraction at 2.25 Å resolution. Released 8 Oct 2014.

Method: X-ray diffraction
Resolution: 2.25 Å
Organisms: Homo sapiens, Eptatretus burgeri
Chains: 4
Atoms: 6,122
Mol. weight: 88.67 kDa
Released: 8 Oct 2014

Explore 4QXF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4QXF contains 11 α-helices and 62 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 5 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	34-35	2	1
β-strand	40-42	3	1
α-helix	51-52	2
β-strand	61-63	3	1
β-strand	71-72	2	2
β-strand	85-87	3	1
β-strand	95-96	2	2
β-strand	109-111	3	1
β-strand	119	1	3
β-strand	133-135	3	1
β-strand	143	1	3
β-strand	157-159	3	1
α-helix	170-173	4
β-strand	181-183	3	1
β-strand	191-192	2	4
β-strand	205-207	3	1
β-strand	215-216	2	4
β-strand	229-231	3	1
α-helix	242-246	5
β-strand	252-254	3	1
β-strand	276-278	3	1
β-strand	284	1	5
α-helix	292-300	9
β-strand	305-306	2	1
β-strand	310	1	6
β-strand	311	1	5
β-strand	317	1	6
α-helix	318-320	3

Chain C: 1 helix, 8 β-strands

Element	Residues	Length	Sheet
β-strand	61-65	5	16
β-strand	72-76	5	16
β-strand	83-86	4	16
β-strand	93-96	4	16
β-strand	102-107	6	17
β-strand	110-114	5	17
α-helix	115	1
β-strand	119-121	3	18
β-strand	124-126	3	18

Chain E: 0 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	61-65	5	13
β-strand	72-76	5	13
β-strand	83-86	4	13
β-strand	93-96	4	13
β-strand	102-107	6	14
β-strand	110-114	5	14
β-strand	119-121	3	15
β-strand	124-126	3	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Leucine-rich repeat-containing G-protein coupled receptor 4, Variable lymphocyte receptor B	A, B	protein	301	Homo sapiens, Eptatretus burgeri	Q4G1L2 (AlphaFold model), Q9BXB1 (AlphaFold model)
R-spondin-1	C, E	protein	102	Homo sapiens	Q2MKA7 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4QXF_1 Leucine-rich repeat-containing G-protein coupled receptor 4, Variable lymphocyte receptor B (chains A, B)
MDPLCAAPCSCDGDRRVDCSGKGLTAVPEGLSAFTQALDISMNNITQLPEGAFKNFPFLE
ELQLAGNDLSFIHPKALSGLKELKVLTLQNNQLKTVPSEAIRGLSALQSLRLDANHITSV
PEDSFEGLVQLRHLWLDDNSLTEVPVHPLSNLPTLQALTLALNKISSIPDFAFTNLSSLV
VLHLHNNKIRSLSQHCFDGLDNLETLDLNYNNLGEFPQAIKALPSLKELALDTNQLKSVP
DGIFDRLTSLQKIWLHTNPWDCSCPRIDYLSRWLNKNSQKEQGSAKCSGSGKPVRSIICP
T

Sequence of entity 2 (C, E), FASTA

>4QXF_2 R-spondin-1 (chains C, E)
AEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNK
CIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSA

Primary citation

crystal structure of human LGR4 and Rspo1. Xu, J.G., Huang, C., Zhou, Y. et al. To be published.

Other PDB entries of the same protein (UniProt Q4G1L2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2Z62 1.7 Å, Crystal structure of the TV3 hybrid of human TLR4 and hagfish VLRB.61
2Z66 1.9 Å, Crystal structure of the VT3 hybrid of human TLR4 and hagfish VLRB.61
2Z63 2.0 Å, Crystal structure of the TV8 hybrid of human TLR4 and hagfish VLRB.61
5GY2 2.1 Å, Crystal structure of a complex between Bacillus subtilis flagellin and zebrafish…
7MLM 2.1 Å, Crystal structure of mouse TLR4/MD-2 in complex with sulfatides
4QXE 2.2 Å, Crystal structure of LGR4 fused with hagfish VLR
6BXA 2.3 Å, Crystal structure of N-terminal fragment of Zebrafish Toll-Like Receptor 5 (TLR5) with…
2O6R 2.3 Å, Structural diversity of the hagfish Variable Lymphocyte Receptors B61
4BV4 2.35 Å, Structure and allostery in Toll-Spatzle recognition
3UL7 2.37 Å, Crystal structure of the TV3 mutant F63W
4QDH 2.4 Å, Crystal Structure of the C-terminal Domain of Mouse TLR9
3A7C 2.4 Å, Crystal structure of TLR2-PE-DTPA complex

Browse structure collections

About this viewer

MolViewer shows 4QXF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.