4UEX: Human Saposin A at lysosomal pH

Structure of human Saposin A at lysosomal pH. Determined by X-ray diffraction at 1.8 Å resolution. Released 15 Jul 2015.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 1,330
Mol. weight: 18.61 kDa
Released: 15 Jul 2015

Explore 4UEX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4UEX contains 8 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	2-19	18
α-helix	24-37	14
α-helix	41-63	23
α-helix	69-75	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Prosaposin	A, B	protein	85	HOMO SAPIENS	P07602 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4UEX_1 PROSAPOSIN (chains A, B)
MGSLPCDICKDVVTAAGDMLKDNATEEEILVYLEKTCDWLPKPNMSASCKEIVDSYLPVI
LDIIKGEMSRPGEVCSALNLCESLQ

Primary citation

Structure of Human Saposin a at Lysosomal Ph. Hill, C.H., Read, R.J., Deane, J.E. Acta Crystallogr D Biol Crystallogr (2015) 71:895. DOI 10.1107/S2053230X15008584 · PubMed

Other PDB entries of the same protein (UniProt P07602 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3BQP 1.3 Å, Crystal Structure of Human Saposin D (orthorhombic)
9I63 1.65 Å, Synthetic Human Saposin D glycoprotein
4DDJ 1.9 Å, Crystal structure of saposin A in complex with lauryldimethylamine-N-oxide (LDAO)
2DOB 2.0 Å, Crystal Structure of Human Saposin A
3BQQ 2.0 Å, Crystal Structure of Human Saposin D (triclinic)
2RB3 2.1 Å, Crystal Structure of Human Saposin D
4V2O 2.13 Å, Structure of saposin B in complex with chloroquine
1N69 2.2 Å, Crystal structure of human saposin B
6SLR 2.38 Å, Structure of saposin B in complex with atovaquone
2GTG 2.4 Å, Crystal Structure of Human Saposin C
2QYP 2.45 Å, Orthorhombic Crystal Structure of Human Saposin C Dimer in Open Conformation
2R0R 2.5 Å, Crystal Structure of Human Saposin D variant SapD K9E

Browse structure collections

About this viewer

MolViewer shows 4UEX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.