4W8P: RIAM TBS1

Crystal structure of RIAM TBS1 in complex with talin R7R8 domains. Determined by X-ray diffraction at 1.5 Å resolution. Released 3 Dec 2014.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Mus musculus
Chains: 2
Atoms: 2,719
Mol. weight: 34.13 kDa
Released: 3 Dec 2014

Explore 4W8P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4W8P contains 13 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	1360-1373	14
α-helix	1374-1377	4
α-helix	1389-1416	28
α-helix	1419-1450	32
β-strand	1455	1	1
β-strand	1458	1	2
α-helix	1464-1480	17
α-helix	1488-1515	28
α-helix	1519-1548	30
α-helix	1552-1576	25
α-helix	1579-1581	3
β-strand	1584	1	2
β-strand	1587	1	1
α-helix	1590-1622	33
α-helix	1627-1653	27

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	6-11	6
α-helix	13-22	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Talin-1	A	protein	301	Mus musculus	P26039 (AlphaFold model)
Amyloid beta A4 precursor protein-binding family B member 1-interacting protein	B	protein	21	Mus musculus	Q8R5A3 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4W8P_1 Talin-1 (chains A)
APGQKECDNALRQLETVRELLENPVQPINDMSYFGCLDSVMENSKVLGEAMTGISQNAKN
GNLPEFGDAIATASKALCGFTEAAAQAAYLVGVSDPNSQAGQQGLVEPTQFARANQAIQM
ACQSLGEPGCTQAQVLSAATIVAKHTSALCNSCRLASARTANPTAKRQFVQSAKEVANST
ANLVKTIKALDGDFTEENRAQCRAATAPLLEAVDNLSAFASNPEFSSVPAQISPEGRAAM
EPIVISAKTMLESAGGLIQTARALAVNPRDPPRWSVLAGHSRTVSDSIKKLITSMRDKAP
G

Sequence of entity 2 (B), FASTA

>4W8P_2 Amyloid beta A4 precursor protein-binding family B member 1-interacting protein (chains B)
NEDIDQMFSTLLGEMDLLTQS

Primary citation

Structural and Mechanistic Insights into the Recruitment of Talin by RIAM in Integrin Signaling. Chang, Y.C., Zhang, H., Franco-Barraza, J. et al. Structure (2014) 22:1810-1820. DOI 10.1016/j.str.2014.09.020 · PubMed

Other PDB entries of the same protein (UniProt P26039 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9SR0 1.49 Å, Mouse vinculin head domain 1 (VD1) (residues 2-258) with A50I mutation in complex with…
9DZ5 1.74 Å, Crystal structure of integrin beta-2 tail bound to the FERM-folded talin head domain…
7V1A 1.84 Å, Stapled TBS peptide from RIAM bound to talin R7R8 domains
3DYJ 1.85 Å, Crystal Structure of the R11R12 Domains of Talin
8FSE 1.9 Å, Crystal structure of integrin beta-2 tail bound to the FERM-folded talin head domain
3IVF 1.94 Å, Crystal structure of the talin head FERM domain
3S90 1.97 Å, Human vinculin head domain Vh1 (residues 1-252) in complex with murine talin (VBS33;…
5IC0 1.97 Å, Structural analysis of a talin triple domain module
8FTB 1.97 Å, Crystal structure of integrin beta-2 tail bound to the FERM-folded talin head domain…
2X0C 2.0 Å, Crystal Structure of the R7R8 domains of Talin
4F7G 2.05 Å, Crystal structure of talin autoinhibition complex
1T01 2.06 Å, Vinculin complexed with the VBS1 helix from talin

Browse structure collections

About this viewer

MolViewer shows 4W8P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.