5AAZ: Optineurin

TBK1 recruitment to cytosol-invading Salmonella induces anti- bacterial autophagy. Determined by solution NMR. Released 13 Jul 2016.

Method: Solution NMR
Organism: HOMO SAPIENS
Chains: 1
Atoms: 240
Mol. weight: 3.59 kDa
Ligands: ZN
Released: 13 Jul 2016

Explore 5AAZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5AAZ contains 1 α-helix and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 2 β-strands

Element	Residues	Length	Sheet
β-strand	496-497	2	1
β-strand	504-505	2	1
α-helix	508-516	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Optineurin	A	protein	32	HOMO SAPIENS	Q96CV9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5AAZ_1 OPTINEURIN (chains A)
GSRNIPIHSCPKCGEVLPDIDTLQIHVMDCII

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Primary citation

Recruitment of Tbk1 to Cytosol-Invading Salmonella Induces Wipi2-Dependent Antibacterial Autophagy. Thurston, T.L., Boyle, K.B., Allen, M. et al. EMBO J (2016) 35:1779. DOI 10.15252/EMBJ.201694491 · PubMed

Other PDB entries of the same protein (UniProt Q96CV9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3VTV 1.7 Å, Crystal structure of Optineurin LIR-fused human LC3B_2-119
9B0B 1.7 Å, Structure of Optineurin bound to HOIP NZF1 domain
9B12 1.81 Å, Structure of Optineurin bound to HOIP NZF1 domain and M1-linked diubiquitin, crystal…
9M0O 1.83 Å, Crystal structure of OPTN 138-170 in complex with GTP-bound RAB8A1-176 (Q67L)
9IKQ 1.93 Å, Crystal structure of OPTN LZD in complex with GTP-bound Rab8a(Q67L)
7CZM 2.0 Å, Crystal structure of FIP200 Claw/p-OPtineurin LIR complex
5EOF 2.05 Å, Crystal structure of OPTN NTD and TBK1 CTD complex
9B0Z 2.41 Å, Structure of Optineurin bound to HOIP NZF1 domain and M1-linked diubiquitin, crystal…
5EOA 2.5 Å, Crystal structure of OPTN E50K mutant and TBK1 complex
3VTW 2.52 Å, Crystal structure of T7-tagged Optineurin LIR-fused human LC3B_2-119
5B83 2.69 Å, Crystal structure of Optineurin UBAN in complex with linear ubiquitin
2LO4 NMR Solution Structure of Optineurin Zinc-finger Domain

Browse structure collections

About this viewer

MolViewer shows 5AAZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.