5BPU: Norrin

Crystal structure of Norrin, a Wnt signalling activator, Crystal Form I. Determined by X-ray diffraction at 2.4 Å resolution. Released 1 Jul 2015.

Method: X-ray diffraction
Resolution: 2.4 Å
Organisms: Homo sapiens, synthetic construct
Chains: 8
Atoms: 5,087
Mol. weight: 83.14 kDa
Released: 1 Jul 2015

Explore 5BPU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5BPU contains 11 α-helices and 53 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	32-33	2	1
α-helix	34-35	2
β-strand	40-48	9	2
β-strand	55	1	3
β-strand	58-67	10	2
α-helix	72	1
β-strand	73-77	5	4
α-helix	78-79	2
β-strand	80	1	5
α-helix	84-85	2
β-strand	89-92	4	4
β-strand	94-109	16	6
β-strand	110	1	3
β-strand	115-130	16	6

Chain B: 1 helix, 8 β-strands

Element	Residues	Length	Sheet
β-strand	40-48	9	4
β-strand	55	1	5
β-strand	58-67	10	4
α-helix	72	1
β-strand	73-77	5	2
β-strand	80	1	6
β-strand	89-92	4	2
β-strand	94-110	17	5
β-strand	114-130	17	5

Chain C: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	40-48	9	7
β-strand	58-67	10	7
α-helix	72	1
β-strand	73-77	5	1
α-helix	78-79	2
β-strand	80	1	8
α-helix	84-85	2
β-strand	89-92	4	1
β-strand	94-111	18	9
β-strand	114-130	17	9

Chain D: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	38	1	10
β-strand	40-48	9	1
β-strand	55	1	11
β-strand	58-67	10	1
β-strand	68	1	10
α-helix	72	1
β-strand	73-77	5	7
β-strand	80	1	9
β-strand	89-92	4	7
β-strand	94-109	16	8
β-strand	110	1	11
β-strand	115-130	16	8

Chain E: 1 helix, 10 β-strands

Element	Residues	Length	Sheet
β-strand	38	1	12
β-strand	40-48	9	13
β-strand	55-56	2	14
β-strand	58-67	10	13
β-strand	68	1	12
α-helix	72	1
β-strand	73-77	5	15
β-strand	80	1	16
β-strand	89-92	4	15
β-strand	94-110	17	14
β-strand	115-130	16	14

Chain F: 1 helix, 7 β-strands

Element	Residues	Length	Sheet
β-strand	40-48	9	15
β-strand	58-67	10	15
α-helix	72	1
β-strand	73-77	5	13
β-strand	80	1	14
β-strand	89-92	4	13
β-strand	94-109	16	16
β-strand	115-130	16	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Norrin	A, B, C, D, E, F	protein	122	Homo sapiens	Q00604 (AlphaFold model)
(ggl)eeeeee	H	protein	7	synthetic construct
(ggl)eee	I	protein	4	synthetic construct

Sequence of entity 1 (A, B, C, D, E, F), FASTA

>5BPU_1 Norrin (chains A, B, C, D, E, F)
GPGKTDSSFIMDSDPRRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSF
STVLKQPFRSSCHCCRPQTSKLKALRLRCSGGMRLTATYRYILSCHCEECNSGTETSQVA
PA

Sequence of entity 2 (H), FASTA

>5BPU_2 (GGL)EEEEEE (chains H)
EEEEEEE

Sequence of entity 3 (I), FASTA

>5BPU_3 (GGL)EEE (chains I)
EEEE

Primary citation

Structure and functional properties of Norrin mimic Wnt for signalling with Frizzled4, Lrp5/6, and proteoglycan. Chang, T.H., Hsieh, F.L., Zebisch, M. et al. Elife (2015) 4:e06554. DOI 10.7554/eLife.06554 · PubMed

Other PDB entries of the same protein (UniProt Q00604 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5BQ8 2.0 Å, Crystal structure of Norrin, a Wnt signalling activator, Crystal Form II
5BQB 2.3 Å, Crystal structure of Norrin, a Wnt signalling activator, Crystal Form III
5BQE 2.3 Å, Crystal structure of Norrin in complex with the cysteine-rich domain of Frizzled 4…
5BQC 3.0 Å, Crystal structure of Norrin in complex with the cysteine-rich domain of Frizzled 4 and…
9UOK 3.05 Å, Structure of the complex of LGR4_ECD with Norrin
8WVY 3.29 Å, Cryo-EM structure of LGR4 in complex with Norrin
8WVX 3.32 Å, Cryo-EM structure of LGR4 in complex with Norrin(dimer)
9KHH 3.65 Å, Structure of the complex of LGR4 with Norrin (2:2)
9MAN 3.78 Å, Structure of Norrin in complex with human Tspan12 large extracellular loop (Tspan12 LEL)
5CL1 3.8 Å, Complex structure of Norrin with human Frizzled 4

Browse structure collections

About this viewer

MolViewer shows 5BPU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.