9KHH: Complex of LGR4 with Norrin

Structure of the complex of LGR4 with Norrin (2:2). Determined by electron microscopy at 3.65 Å resolution. Released 16 Jul 2025.

Method: Electron microscopy
Resolution: 3.65 Å
Organisms: Camelus dromedarius, Homo sapiens
Chains: 6
Atoms: 12,354
Mol. weight: 419.95 kDa
Released: 16 Jul 2025

Explore 9KHH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9KHH contains 45 α-helices and 103 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	424-426	3	1
β-strand	439-445	7	2
β-strand	451-458	8	2
β-strand	463-465	3	2
α-helix	467-469	3
β-strand	473-475	3	1
β-strand	478	1	3
β-strand	483	1	3
β-strand	486-488	3	1
α-helix	493-495	3
β-strand	497-504	8	2
β-strand	520-521	2	2
β-strand	525-527	3	2

Chain C: 19 helices, 31 β-strands

Element	Residues	Length	Sheet
β-strand	36	1	14
β-strand	40-42	3	14
α-helix	51-53	3
β-strand	61-63	3	14
β-strand	71-72	2	15
β-strand	85-87	3	14
β-strand	95-96	2	15
β-strand	109-111	3	14
β-strand	119	1	16
α-helix	122-125	4
β-strand	133-135	3	14
β-strand	143	1	16
β-strand	157-159	3	14
α-helix	170-174	5
β-strand	181-183	3	14
β-strand	191-192	2	17
β-strand	205-207	3	14
β-strand	215-216	2	17
β-strand	229-231	3	14
α-helix	242-246	5
β-strand	252-254	3	14
β-strand	262-263	2	18
β-strand	276-278	3	14
β-strand	286-287	2	18
β-strand	300-304	5	14
α-helix	312-313	2
β-strand	323-327	5	14
α-helix	338-341	4
β-strand	347-349	3	14
β-strand	369-371	3	14
β-strand	380	1	19
β-strand	393-395	3	14
β-strand	404	1	19
α-helix	406-409	4
β-strand	417-419	3	14
β-strand	438-440	3	14
β-strand	461-463	3	14
β-strand	521-522	2	14
α-helix	539-566	28
α-helix	572-600	29
α-helix	605-614	10
α-helix	616-648	33
α-helix	659-682	24
α-helix	687-689	3
α-helix	704-729	26
α-helix	742-746	5
α-helix	747-767	21
α-helix	779-789	11
α-helix	792-802	11
α-helix	806-819	14

Chain D: 19 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	36	1	20
β-strand	40-42	3	20
α-helix	51-53	3
β-strand	61-63	3	20
β-strand	71-72	2	21
β-strand	85-87	3	20
β-strand	95-96	2	21
β-strand	109-111	3	20
β-strand	119	1	22
α-helix	122-125	4
β-strand	133-135	3	20
β-strand	143	1	22
β-strand	157-159	3	20
α-helix	170-174	5
β-strand	181-183	3	20
β-strand	191-192	2	23
β-strand	205-207	3	20
β-strand	215-216	2	23
β-strand	229-231	3	20
α-helix	242-246	5
β-strand	252-254	3	20
β-strand	262-263	2	24
β-strand	276-278	3	20
β-strand	286-287	2	24
β-strand	300-304	5	20
α-helix	312-313	2
β-strand	323-327	5	20
α-helix	338-341	4
β-strand	347-349	3	20
β-strand	369-371	3	20
β-strand	380	1	25
β-strand	393-395	3	20
β-strand	404	1	25
α-helix	406-409	4
β-strand	417-419	3	20
β-strand	438-440	3	20
β-strand	461-463	3	20
α-helix	539-566	28
α-helix	572-600	29
α-helix	605-614	10
α-helix	616-648	33
α-helix	659-682	24
α-helix	687-689	3
α-helix	704-729	26
α-helix	742-746	5
α-helix	747-767	21
α-helix	779-789	11
α-helix	792-802	11
α-helix	806-819	14

Chain E: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	40-46	7	4
β-strand	55	1	5
β-strand	60-67	8	4
α-helix	72	1
β-strand	73-77	5	6
β-strand	80	1	7
β-strand	89-92	4	6
β-strand	94-97	4	8
β-strand	101-109	9	9
β-strand	110	1	5
β-strand	115-123	9	9
β-strand	127-130	4	8

Chain F: 2 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	40-48	9	6
β-strand	55	1	10
β-strand	58-67	10	6
α-helix	72	1
β-strand	73-77	5	4
β-strand	79-80	2	9
β-strand	89-92	4	4
β-strand	94-109	16	7
β-strand	110	1	10
α-helix	111-113	3
β-strand	115-130	16	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
MB52	A, B	protein	556	Camelus dromedarius
Norrin,Immunoglobulin gamma-1 heavy chain	E, F	protein	409	Homo sapiens	Q00604 (AlphaFold model)
Leucine-rich repeat-containing G-protein coupled receptor 4	C, D	protein	954	Homo sapiens	Q9BXB1 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>9KHH_1 MB52 (chains A, B)
MKKIWLALAGLVLAFSASAQVQLVESGGGLVQTKTTTSVIDTTNDAQNLLTQAQTIVNTL
KDYCPILIAKSSSSNGGTNNANTPSWQTAGGGKNSCATFGAEFSAASDMINNAQKIVQET
QQLSANQPKNITQPHNLNLNSPSSLTALAQKMLKNAQSQAEILKLANQVESDFNKLSSGH
LKDYIGKCDASAISSANMTMQNQKNNWGNGCAGVEETQSLLKTSAADFNNQTPQINQAQN
LANTLIQELGNNPFRASGGGSGGGGSGKLSDTYEQLSRLLTNDNGTNSKTSAQAINQAVN
NLNERAKTLAGGTTNSPAYQATLLALRSVLGLWNSMGYAVICGGYTKSPGENNQKDFHYT
DENGNGTTINCGGSTNSNGTHSYNGTNTLKADKNVSLSIEQYEKIHEAYQILSKALKQAG
LAPLNSKGEKLEAHVTTSKYGSLRLSCAASGYTYSPYCMGWFRQAPGKAREGVATVDLDG
STIYADSVKGRFTISQDNAKNTLYLQMNSLKPEDTAMYYCASRTRAGVTCGLNWAIFSYW
GQGTQVTVSSHHHHHH

Sequence of entity 2 (E, F), FASTA

>9KHH_2 Norrin,Immunoglobulin gamma-1 heavy chain (chains E, F)
MLLVNQSHQGFNKEHTSKMVSAIVLYVLLAAAAHSAFAKTDSSFIMDSDPRRCMRHHYVD
SISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTVLKQPFRSSCHCCRPQTSKLKAL
RLRCSGGMRLTATYRYILSCHCEECNSGGSGGSGGLEVLFQGPGGSGGSGGKSCDKTHTC
PPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHN
AKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREP
QVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKATPPVLDSDGSFFL
YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKDYKDDDDK

Sequence of entity 3 (C, D), FASTA

>9KHH_3 Leucine-rich repeat-containing G-protein coupled receptor 4 (chains C, D)
MKTIIALSYIFCLVFAAPPLCAAPCSCDGDRRVDCSGKGLTAVPEGLSAFTQALDISMNN
ITQLPEDAFKNFPFLEELQLAGNDLSFIHPKALSGLKELKVLTLQNNQLKTVPSEAIRGL
SALQSLRLDANHITSVPEDSFEGLVQLRHLWLDDNSLTEVPVHPLSNLPTLQALTLALNK
ISSIPDFAFTNLSSLVVLHLHNNKIRSLSQHCFDGLDNLETLDLNYNNLGEFPQAIKALP
SLKELGFHSNSISVIPDGAFDGNPLLRTIHLYDNPLSFVGNSAFHNLSDLHSLVIRGASM
VQQFPNLTGTVHLESLTLTGTKISSIPNNLCQEQKMLRTLDLSYNNIRDLPSFNGCHALE
EISLQRNQIYQIKEGTFQGLISLRILDLSRNLIHEIHSRAFATLGPITNLDVSFNELTSF
PTEGLNGLNQLKLVGNFKLKEALAAKDFVNLRSLSVPYAYQCCAFWGCDSYANLNTEDNS
LQDHSVAQEKGTADAANVTSTLENEEHSQIIIHCTPSTGAFKPCEYLLGSWMIRLTVWFI
FLVALFFNLLVILTTFASCTSLPSSKLFIGLISVSNLFMGIYTGILTFLDAVSWGRFAEF
GIWWETGSGCKVAGFLAVFSSESAIFLLMLATVERSLSAKDIMKNGKSNHLKQFRVAALL
AFLGATVAGCFPLFHRGEYSASPLCLPFPTGETPSLGFTVTLVLLNSLAFLLMAVIYTKL
YCNLEKEDLSENSQSSMIKHVAWLIFTNCIFFCPVAFFSFAPLITAISISPEIMKSVTLI
FFPLPACLNPVLYVFFNPKFKEDWKLLKRRVTKKSGSVSVSISSQGGCLEQDFYYDCGMY
SHLQGNLTVCDCCESFLLTKPVSCKHLIKSHSCPALAVASCQRPEGYWSDCGTQSAHSDY
ADEEDSFVSDSSDQVQACGRACFYQSRGFPLVRYAYNLPRVKDAAADYKDDDDK

Primary citation

Structure of the complex of LGR4 with Norrin (2:2). Yong, G., Hu, F.Z., Qiao, H.R. To be published.

Other PDB entries of the same protein (UniProt Q00604 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5BQ8 2.0 Å, Crystal structure of Norrin, a Wnt signalling activator, Crystal Form II
5BQB 2.3 Å, Crystal structure of Norrin, a Wnt signalling activator, Crystal Form III
5BQE 2.3 Å, Crystal structure of Norrin in complex with the cysteine-rich domain of Frizzled 4…
5BPU 2.4 Å, Crystal structure of Norrin, a Wnt signalling activator, Crystal Form I
5BQC 3.0 Å, Crystal structure of Norrin in complex with the cysteine-rich domain of Frizzled 4 and…
9UOK 3.05 Å, Structure of the complex of LGR4_ECD with Norrin
8WVY 3.29 Å, Cryo-EM structure of LGR4 in complex with Norrin
8WVX 3.32 Å, Cryo-EM structure of LGR4 in complex with Norrin(dimer)
9MAN 3.78 Å, Structure of Norrin in complex with human Tspan12 large extracellular loop (Tspan12 LEL)
5CL1 3.8 Å, Complex structure of Norrin with human Frizzled 4

Browse structure collections

About this viewer

MolViewer shows 9KHH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.