5BQB: Norrin

Crystal structure of Norrin, a Wnt signalling activator, Crystal Form III. Determined by X-ray diffraction at 2.3 Å resolution. Released 1 Jul 2015.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,230
Mol. weight: 55.3 kDa
Ligands: CIT
Released: 1 Jul 2015

Explore 5BQB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5BQB contains 7 α-helices and 32 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	40-48	9	1
β-strand	55-56	2	2
β-strand	58-67	10	1
α-helix	72	1
β-strand	73-77	5	3
β-strand	80	1	4
α-helix	84-85	2
β-strand	89-92	4	3
β-strand	94-110	17	2
β-strand	115-130	16	2

Chain B: 1 helix, 8 β-strands

Element	Residues	Length	Sheet
β-strand	40-48	9	3
β-strand	55	1	4
β-strand	58-67	10	3
α-helix	72	1
β-strand	73-77	5	1
β-strand	80	1	2
β-strand	89-92	4	1
β-strand	94-110	17	4
β-strand	114-130	17	4

Chain C: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	40-48	9	5
β-strand	55	1	6
β-strand	58-67	10	5
α-helix	72	1
β-strand	73-77	5	7
α-helix	78-79	2
β-strand	80	1	8
β-strand	89-92	4	7
β-strand	94-110	17	6
β-strand	114-130	17	6

Chain D: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	40-47	8	7
β-strand	55	1	8
β-strand	59-67	9	7
α-helix	72	1
β-strand	73-77	5	5
α-helix	78-79	2
β-strand	80	1	6
β-strand	89-92	4	5
β-strand	94-110	17	8
β-strand	114-130	17	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Norrin	A, B, C, D	protein	122	Homo sapiens	Q00604 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>5BQB_1 Norrin (chains A, B, C, D)
GPGKTDSSFIMDSDPRRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSF
STVLKQPFRSSCHCCRPQTSKLKALRLRCSGGMRLTATYRYILSCHCEECNSGTETSQVA
PA

Ligands and cofactors

ID	Name	Formula	Copies
CIT	Citric acid	C6 H8 O7	4

Water and common crystallization additives (CL) are not listed.

Primary citation

Structure and functional properties of Norrin mimic Wnt for signalling with Frizzled4, Lrp5/6, and proteoglycan. Chang, T.H., Hsieh, F.L., Zebisch, M. et al. Elife (2015) 4:e06554. DOI 10.7554/eLife.06554 · PubMed

Other PDB entries of the same protein (UniProt Q00604 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5BQ8 2.0 Å, Crystal structure of Norrin, a Wnt signalling activator, Crystal Form II
5BQE 2.3 Å, Crystal structure of Norrin in complex with the cysteine-rich domain of Frizzled 4…
5BPU 2.4 Å, Crystal structure of Norrin, a Wnt signalling activator, Crystal Form I
5BQC 3.0 Å, Crystal structure of Norrin in complex with the cysteine-rich domain of Frizzled 4 and…
9UOK 3.05 Å, Structure of the complex of LGR4_ECD with Norrin
8WVY 3.29 Å, Cryo-EM structure of LGR4 in complex with Norrin
8WVX 3.32 Å, Cryo-EM structure of LGR4 in complex with Norrin(dimer)
9KHH 3.65 Å, Structure of the complex of LGR4 with Norrin (2:2)
9MAN 3.78 Å, Structure of Norrin in complex with human Tspan12 large extracellular loop (Tspan12 LEL)
5CL1 3.8 Å, Complex structure of Norrin with human Frizzled 4

Browse structure collections

About this viewer

MolViewer shows 5BQB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.