Crystal structure of the inactive form of human calcium-sensing receptor extracellular domain. Determined by X-ray diffraction at 3.1 Å resolution. Released 3 Aug 2016.
Explore 5K5T in 3D Show helices and sheets RCSB PDB PDBe
5K5T contains 29 α-helices and 40 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 26-28 | 3 | 1 |
| β-strand | 32-38 | 7 | 1 |
| β-strand | 41 | 1 | 2 |
| β-strand | 44 | 1 | 3 |
| α-helix | 55-59 | 5 | |
| β-strand | 60 | 1 | 3 |
| β-strand | 63 | 1 | 2 |
| α-helix | 65-83 | 19 | |
| β-strand | 93-99 | 7 | 1 |
| α-helix | 104-115 | 12 | |
| α-helix | 116-120 | 5 | |
| α-helix | 121-123 | 3 | |
| α-helix | 125-128 | 4 | |
| β-strand | 138-142 | 5 | 1 |
| α-helix | 147-157 | 11 | |
| α-helix | 158-160 | 3 | |
| β-strand | 164-166 | 3 | 1 |
| α-helix | 172-175 | 4 | |
| β-strand | 183-185 | 3 | 1 |
| α-helix | 192-203 | 12 | |
| β-strand | 208-214 | 7 | 4 |
| α-helix | 219-232 | 14 | |
| β-strand | 236-243 | 8 | 4 |
| α-helix | 249-261 | 13 | |
| β-strand | 266-270 | 5 | 4 |
| α-helix | 273-286 | 14 | |
| β-strand | 292-295 | 4 | 4 |
| α-helix | 297-300 | 4 | |
| α-helix | 308-310 | 3 | |
| α-helix | 311-314 | 4 | |
| β-strand | 318-322 | 5 | 4 |
| β-strand | 325 | 1 | 5 |
| α-helix | 330-335 | 6 | |
| β-strand | 345 | 1 | 1 |
| α-helix | 347-356 | 10 | |
| β-strand | 359-360 | 2 | 6 |
| α-helix | 374-378 | 5 | |
| α-helix | 387-389 | 3 | |
| β-strand | 394-395 | 2 | 6 |
| β-strand | 414 | 1 | 5 |
| α-helix | 416-436 | 21 | |
| β-strand | 442 | 1 | 7 |
| β-strand | 444 | 1 | 8 |
| β-strand | 447 | 1 | 7 |
| β-strand | 448 | 1 | 8 |
| α-helix | 457-465 | 9 | |
| β-strand | 468-470 | 3 | 9 |
| β-strand | 476-478 | 3 | 9 |
| β-strand | 479 | 1 | 10 |
| β-strand | 484 | 1 | 1 |
| β-strand | 485 | 1 | 10 |
| β-strand | 488-496 | 9 | 4 |
| β-strand | 503-512 | 10 | 4 |
| β-strand | 521-523 | 3 | 4 |
| α-helix | 525-527 | 3 | |
| β-strand | 530 | 1 | 11 |
| β-strand | 534 | 1 | 11 |
| α-helix | 537-539 | 3 | |
| α-helix | 544-546 | 3 | |
| β-strand | 550-554 | 5 | 12 |
| α-helix | 555 | 1 | |
| β-strand | 563-567 | 5 | 12 |
| α-helix | 568-569 | 2 | |
| β-strand | 572-573 | 2 | 13 |
| α-helix | 582 | 1 | |
| β-strand | 583-584 | 2 | 13 |
| α-helix | 585-586 | 2 | |
| β-strand | 589-591 | 3 | 14 |
| β-strand | 598-600 | 3 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Extracellular calcium-sensing receptor | A | protein | 615 | Homo sapiens | P41180 (AlphaFold model) |
>5K5T_1 Extracellular calcium-sensing receptor (chains A) MAFYSCCWVLLALTWHTSAYGPDQRAQKKGDIILGGLFPIHFGVAAKDQDLKSRPESVEC IRYNFRGFRWLQAMIFAIEEINSSPALLPNLTLGYRIFDTCNTVSKALEATLSFVAQNKI DSLNLDEFCNCSEHIPSTIAVVGATGSGVSTAVANLLGLFYIPQVSYASSSRLLSNKNQF KSFLRTIPNDEHQATAMADIIEYFRWNWVGTIAADDDYGRPGIEKFREEAEERDICIDFS ELISQYSDEEEIQHVVEVIQNSTAKVIVVFSSGPDLEPLIKEIVRRNITGKIWLASEAWA SSSLIAMPQYFHVVGGTIGFALKAGQIPGFREFLKKVHPRKSVHNGFAKEFWEETFNCHL QEGAKGPLPVDTFLRGHEESGDRFSQSSTAFRPLCTGDENINSVETPYIDYTHLRISYNV YLAVYSIAHALQDIYTCLPGRGLFTNGSCADIKKVEAWQVLKHLRHLNFTNNMGEQVTFD ECGDLVGNYSIINWHLSPEDGSIVFKEVGYYNVYAKKGERLFINEEKILWSGFSREVPFS NCSRDCLAGTRKGIIEGEPTCCFECVECPDGEYSDETDASACNKCPDDFWSNENHTSCIA KEIEFLSDYKDDDDK
Water and common crystallization additives (SO4) are not listed.
Structural mechanism of ligand activation in human calcium-sensing receptor. Geng, Y., Mosyak, L., Kurinov, I. et al. Elife (2016) 5. DOI 10.7554/eLife.13662 · PubMed
Other PDB entries of the same protein (UniProt P41180 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5K5T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.