Crystal Structure of the GOLD domain of ACBD3. Determined by X-ray diffraction at 2.49 Å resolution. Released 23 Nov 2016.
Explore 5TDQ in 3D Show helices and sheets RCSB PDB PDBe
5TDQ contains 2 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 370-372 | 3 | |
| β-strand | 373-377 | 5 | 1 |
| α-helix | 380-388 | 9 | |
| β-strand | 395-397 | 3 | 1 |
| β-strand | 402-408 | 7 | 2 |
| β-strand | 415-422 | 8 | 1 |
| β-strand | 427-434 | 8 | 2 |
| β-strand | 442-444 | 3 | 2 |
| β-strand | 477-485 | 9 | 2 |
| β-strand | 491-497 | 7 | 1 |
| β-strand | 503-509 | 7 | 2 |
| β-strand | 518-525 | 8 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Golgi resident protein GCP60 | A | protein | 166 | Homo sapiens | Q9H3P7 (AlphaFold model) |
>5TDQ_1 Golgi resident protein GCP60 (chains A) GSHMPVIAAPSMWTRPQIKDFKEKIQQDADSVITVGRGEVVTVRVPTHEEGSYLFWEFAT DNYDIGFGVYFEWTDSPNTAVSVHVSESSDDDEEEEENIGCEEKAKKNANKPLLDEIVPV YRRDCHEEVYAGSHQYPGRGVYLLKFDNSYSLWRSKSVYYRVYYTR
The Molecular Basis of Aichi Virus 3A Protein Activation of Phosphatidylinositol 4 Kinase III beta , PI4KB, through ACBD3. McPhail, J.A., Ottosen, E.H., Jenkins, M.L. et al. Structure (2017) 25:121-131. DOI 10.1016/j.str.2016.11.016 · PubMed
Other PDB entries of the same protein (UniProt Q9H3P7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5TDQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.