5U7G: Catalytic Core of CBP

Crystal Structure of the Catalytic Core of CBP. Determined by X-ray diffraction at 2.4 Å resolution. Released 21 Jun 2017.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Mus musculus
Chains: 2
Atoms: 8,905
Mol. weight: 145.8 kDa
Ligands: ZN
Released: 21 Jun 2017

Explore 5U7G in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5U7G contains 64 α-helices and 32 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 32 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	1088-1103	16
α-helix	1110-1112	3
α-helix	1118-1121	4
α-helix	1126-1129	4
α-helix	1136-1145	10
α-helix	1151-1168	18
α-helix	1174-1196	23
β-strand	1206	1	1
α-helix	1277	1
β-strand	1278	1	1
α-helix	1279-1280	2
β-strand	1281-1283	3	2
β-strand	1290-1292	3	2
α-helix	1293-1296	4
α-helix	1310-1314	5
α-helix	1320-1322	3
α-helix	1331-1332	2
α-helix	1334-1350	17
β-strand	1358-1371	14	3
α-helix	1372-1373	2
α-helix	1374-1376	3
α-helix	1377-1381	5
β-strand	1389-1403	15	3
β-strand	1406-1418	13	3
α-helix	1423	1
β-strand	1429-1437	9	3
α-helix	1444-1446	3
α-helix	1447-1465	19
β-strand	1469-1473	5	3
α-helix	1497-1513	17
β-strand	1519-1522	4	3
α-helix	1523-1530	8
α-helix	1535-1537	3
α-helix	1545-1555	11
α-helix	1622-1628	7
α-helix	1630-1632	3
β-strand	1633-1637	5	3
α-helix	1648-1650	3
α-helix	1655-1656	2
α-helix	1660-1662	3
α-helix	1666-1675	10
α-helix	1682-1699	18
β-strand	1707	1	4
β-strand	1714	1	4
β-strand	1718-1721	4	5
β-strand	1728-1729	2	5
α-helix	1731-1734	4
β-strand	1743-1746	4	5

Chain B: 32 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	1088-1103	16
α-helix	1110-1112	3
α-helix	1118-1121	4
α-helix	1126-1129	4
α-helix	1136-1145	10
α-helix	1151-1168	18
α-helix	1174-1196	23
β-strand	1206	1	6
α-helix	1277	1
β-strand	1278	1	6
α-helix	1279-1280	2
β-strand	1281-1283	3	7
β-strand	1290-1292	3	7
α-helix	1293-1296	4
α-helix	1310-1314	5
α-helix	1320-1322	3
α-helix	1331-1332	2
α-helix	1334-1350	17
β-strand	1358-1371	14	8
α-helix	1372-1373	2
α-helix	1374-1376	3
α-helix	1377-1381	5
β-strand	1389-1403	15	8
β-strand	1406-1418	13	8
α-helix	1423	1
β-strand	1429-1437	9	8
α-helix	1444-1446	3
α-helix	1447-1465	19
β-strand	1469-1473	5	8
α-helix	1497-1513	17
β-strand	1519-1522	4	8
α-helix	1523-1529	7
α-helix	1535-1537	3
α-helix	1545-1555	11
α-helix	1622-1628	7
α-helix	1630-1632	3
β-strand	1633-1637	5	8
α-helix	1648-1650	3
α-helix	1655-1656	2
α-helix	1660-1662	3
α-helix	1666-1675	10
α-helix	1682-1699	18
β-strand	1707	1	9
β-strand	1714	1	9
β-strand	1718-1721	4	10
β-strand	1728-1729	2	10
α-helix	1731-1736	6
β-strand	1743-1746	4	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CREB-binding protein	A, B	protein	621	Mus musculus	P45481 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5U7G_1 CREB-binding protein (chains A, B)
GAMGSSQPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNP
MDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPV
MQSLGYCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTLG
DDPSQPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCL
KKTGRPRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVK
PGMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYIS
YLDSIHFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQK
IPKPKRLQEWYKKMLDKAFAERIINDYKDIFKQANEDRLTSAKELPYFEGDFWPNVLEES
IKESGGSGSQKLYATMEKHKEVFFVIHLHAGPVISTQPPIVDPDPLLSCDLMDGRDAFLT
LARDKHWEFSSLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLC
INCYNTKSHTHKMVKWGLGLD

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	8

Primary citation

Role of the CBP catalytic core in intramolecular SUMOylation and control of histone H3 acetylation. Park, S., Stanfield, R.L., Martinez-Yamout, M.A. et al. Proc Natl Acad Sci U S A (2017) 114:E5335-E5342. DOI 10.1073/pnas.1703105114 · PubMed

Other PDB entries of the same protein (UniProt P45481 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5W0I 1.43 Å, CREBBP Bromodomain in complex with Cpd8 (1-(3-(7-(difluoromethyl)-6-(1-methyl-1H-pyrazol-…
8CNB 1.99 Å, Crystal structure of CREBBP-Y1503C histone acetyltransferase domain in complex with…
4I9O 2.0 Å, Crystal Structure of GACKIX L664C Tethered to 1-10
7LVS 2.02 Å, The CBP TAZ1 Domain in Complex with a CITED2-HIF-1-Alpha Fusion Peptide
8CMZ 2.25 Å, Crystal structure of CREBBP-R1446C histone acetyltransferase domain in complex with…
6DNQ 2.35 Å, HBZ77 in complex with KIX and c-Myb
8CN0 2.44 Å, Crystal structure of CREBBP-Y1482N histone acetyltransferase domain in complex with…
8CNA 2.46 Å, Crystal structure of CREBBP-R1446C histone acetyltransferase domain in complex with a…
8OG2 2.47 Å, Crystal structure of CREBBP histone acetyltransferase domain in complex with Coenzyme A
6DMX 2.8 Å, HBZ56 in complex with KIX and c-Myb
8CND 2.97 Å, Crystal structure of CREBBP-Y1482N histone acetyltransferase domain in complex with a…
1F81 Solution structure of the TAZ2 domain of the transcriptional adaptor protein cbp

Browse structure collections

About this viewer

MolViewer shows 5U7G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.