5V8W: Human Integrator IntS9-IntS11 CTD complex
Crystal structure of human Integrator IntS9-IntS11 CTD complex. Determined by X-ray diffraction at 2.1 Å resolution. Released 12 Apr 2017.
- Method
- X-ray diffraction
- Resolution
- 2.1 Å
- Organism
- Homo sapiens
- Chains
- 8
- Atoms
- 6,055
- Mol. weight
- 86.71 kDa
- Released
- 12 Apr 2017
Explore 5V8W in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
5V8W contains 36 α-helices and 44 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 3 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 585-586 | 2 | 1 |
| α-helix | 591-600 | 10 | |
| β-strand | 607-610 | 4 | 2 |
| β-strand | 615-619 | 5 | 2 |
| α-helix | 621-623 | 3 | |
| β-strand | 624-629 | 6 | 2 |
| β-strand | 632-638 | 7 | 2 |
| α-helix | 641-652 | 12 | |
| β-strand | 656-657 | 2 | 1 |
Chain B: 5 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 495-500 | 6 | |
| α-helix | 504-507 | 4 | |
| β-strand | 508-518 | 11 | 2 |
| α-helix | 523-537 | 15 | |
| β-strand | 543-545 | 3 | 2 |
| β-strand | 551-553 | 3 | 2 |
| β-strand | 556-560 | 5 | 2 |
| β-strand | 569-577 | 9 | 2 |
| α-helix | 578-580 | 3 | |
| α-helix | 581-591 | 11 | |
Chain C: 3 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 585-587 | 3 | 3 |
| α-helix | 591-600 | 10 | |
| β-strand | 607-609 | 3 | 4 |
| β-strand | 614-618 | 5 | 4 |
| α-helix | 621-623 | 3 | |
| β-strand | 625-629 | 5 | 4 |
| β-strand | 632-638 | 7 | 4 |
| α-helix | 641-652 | 12 | |
| β-strand | 655-657 | 3 | 3 |
Chain D: 7 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 495-502 | 8 | |
| α-helix | 504-507 | 4 | |
| β-strand | 508-518 | 11 | 4 |
| α-helix | 523-537 | 15 | |
| β-strand | 543-545 | 3 | 4 |
| β-strand | 551-553 | 3 | 4 |
| β-strand | 556-560 | 5 | 4 |
| α-helix | 561 | 1 | |
| α-helix | 563-564 | 2 | |
| β-strand | 569-577 | 9 | 4 |
| α-helix | 578-580 | 3 | |
| α-helix | 581-592 | 12 | |
Chain E: 3 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 585-586 | 2 | 5 |
| α-helix | 591-600 | 10 | |
| β-strand | 607-610 | 4 | 6 |
| β-strand | 615-619 | 5 | 6 |
| α-helix | 621-623 | 3 | |
| β-strand | 624-629 | 6 | 6 |
| β-strand | 632-638 | 7 | 6 |
| α-helix | 641-653 | 13 | |
| β-strand | 656-657 | 2 | 5 |
Chain F: 5 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 506-507 | 2 | |
| β-strand | 508-516 | 9 | 6 |
| α-helix | 526-537 | 12 | |
| β-strand | 543-545 | 3 | 6 |
| β-strand | 551-553 | 3 | 6 |
| β-strand | 556-560 | 5 | 6 |
| α-helix | 561-562 | 2 | |
| β-strand | 571-577 | 7 | 6 |
| α-helix | 578-580 | 3 | |
| α-helix | 581-591 | 11 | |
Chain G: 3 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 585-586 | 2 | 7 |
| α-helix | 591-600 | 10 | |
| β-strand | 606-611 | 6 | 8 |
| β-strand | 614-619 | 6 | 8 |
| α-helix | 620-622 | 3 | |
| β-strand | 624-629 | 6 | 8 |
| β-strand | 632-638 | 7 | 8 |
| α-helix | 641-652 | 12 | |
| β-strand | 656-657 | 2 | 7 |
Chain H: 7 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 495-502 | 8 | |
| α-helix | 504-507 | 4 | |
| β-strand | 508-517 | 10 | 8 |
| α-helix | 523-525 | 3 | |
| α-helix | 526-537 | 12 | |
| β-strand | 543-545 | 3 | 8 |
| β-strand | 551-553 | 3 | 8 |
| β-strand | 556-560 | 5 | 8 |
| α-helix | 561-562 | 2 | |
| β-strand | 570-577 | 8 | 8 |
| α-helix | 578-580 | 3 | |
| α-helix | 581-591 | 11 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Integrator complex subunit 9 | A, C, E, G | protein | 78 | Homo sapiens | Q9NV88 (AlphaFold model) |
| Integrator complex subunit 11 | B, D, F, H | protein | 114 | Homo sapiens | Q5TA45 (AlphaFold model) |
Sequence of entity 1 (A, C, E, G), FASTA
>5V8W_1 Integrator complex subunit 9 (chains A, C, E, G)
MKPLLSGSIPVEQFVQTLEKHGFSDIKVEDTAKGHIVLLQEAETLIQIEEDSTHIICDND
EMLRVRLRDLVLKFLQKF
Sequence of entity 2 (B, D, F, H), FASTA
>5V8W_2 Integrator complex subunit 11 (chains B, D, F, H)
GSHMRLVSSEQALKELGLAEHQLRFTCRVHLHDTRKEQETALRVYSHLKSVLKDHCVQHL
PDGSVTVESVLLQAAAPSEDPGTKVLLVSWTYQDEELGSFLTSLLKKGLPQAPS
Primary citation
Molecular basis for the interaction between Integrator subunits IntS9 and IntS11 and its functional importance. Wu, Y., Albrecht, T.R., Baillat, D. et al. Proc Natl Acad Sci U S A (2017) 114:4394-4399. DOI 10.1073/pnas.1616605114 · PubMed
Other PDB entries of the same protein (UniProt Q9NV88 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 8RC4 3.1 Å, Structure of Integrator-PP2A complex
- 8R23 3.2 Å, INTS9-INTS11-BRAT1 complex
- 8UIB 3.21 Å, Structure of the human INTS9-INTS11-BRAT1 complex
- 7CUN 3.5 Å, The structure of human Integrator-PP2A complex
- 7BFP 3.56 Å, Structure of the Integrator cleavage module with INTS4/9/11
- 7PKS 3.6 Å, Structural basis of Integrator-mediated transcription regulation
- 8RBZ 3.7 Å, Structure of Integrator-PP2A-SOSS-CTD post-termination complex
- 8R22 3.9 Å, INTS9-INTS11-BRAT1-WDR73 complex
- 8R2D 3.9 Å, Integrator cleavage module assembly intermediate
- 8RBX 4.1 Å, Structure of Integrator-PP2A bound to a paused RNA polymerase II-DSIF-NELF-nucleosome…
- 8YJB 4.1 Å, Cryo-EM structure of the human DSS1-INTAC complex
- 7BFQ 4.15 Å, Structure of the Integrator cleavage module with extended INTS4 and rigid body docked…
Browse structure collections
About this viewer
MolViewer shows 5V8W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.