6AEZ: Human CCL5 trimer

Crystal structure of human CCL5 trimer. Determined by X-ray diffraction at 1.63 Å resolution. Released 7 Aug 2019.

Method: X-ray diffraction
Resolution: 1.63 Å
Organism: Homo sapiens
Chains: 3
Atoms: 1,810
Mol. weight: 24.47 kDa
Released: 7 Aug 2019

Explore 6AEZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6AEZ contains 12 α-helices and 14 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	14-16	3	1
α-helix	19-21	3
α-helix	22-24	3
β-strand	25-30	6	2
α-helix	31-32	2
β-strand	40-44	5	2
β-strand	49-52	4	2
α-helix	57-64	8
β-strand	68	1	2

Chain B: 4 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	9-11	3	3
β-strand	14-16	3	1
α-helix	19-21	3
α-helix	22-24	3
β-strand	25-30	6	4
α-helix	31-32	2
β-strand	40-44	5	4
β-strand	49-52	4	4
α-helix	57-65	9

Chain C: 4 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	9-11	3	3
α-helix	19-21	3
α-helix	22-24	3
β-strand	25-30	6	5
α-helix	31-32	2
β-strand	40-44	5	5
β-strand	49-52	4	5
α-helix	57-66	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
C-C motif chemokine 5	A, C	protein	69	Homo sapiens	P13501 (AlphaFold model)
C-C motif chemokine 5	B	protein	69	Homo sapiens	P13501 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>6AEZ_1 C-C motif chemokine 5 (chains A, C)
MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVR
EYINSLSMS

Sequence of entity 2 (B), FASTA

>6AEZ_2 C-C motif chemokine 5 (chains B)
MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVR
EYINSLEMS

Primary citation

Integrative Model to Coordinate the Oligomerization and Aggregation Mechanisms of CCL5. Chen, Y.C., Chen, S.P., Li, J.Y. et al. J Mol Biol (2020) 432:1143-1157. DOI 10.1016/j.jmb.2019.12.049 · PubMed

Other PDB entries of the same protein (UniProt P13501 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5COY 1.44 Å, Crystal structure of CC chemokine 5 (CCL5)
6STK 1.52 Å, Crystal structure of the CC-chemokine 5 (CCL5) E66S mutation
1B3A 1.6 Å, Total chemical synthesis and high-resolution crystal structure of the potent anti-HIV…
1EQT 1.6 Å, Met-rantes
1U4P 1.7 Å, Crystal Structure of human RANTES mutant K45E
2VXW 1.7 Å, Structural and Functional Studies of the Potent Anti-HIV Chemokine Variant P2-RANTES
1U4L 2.0 Å, human RANTES complexed to heparin-derived disaccharide I-S
1U4M 2.0 Å, human RANTES complexed to heparin-derived disaccharide III-S
1U4R 2.2 Å, Crystal Structure of human RANTES mutant 44-AANA-47
5UIW 2.2 Å, Crystal Structure of CC Chemokine Receptor 5 (CCR5) in complex with high potency HIV…
5L2U 2.28 Å, Oligomer crystal structure of CC chemokine 5 (CCL5)
5DNF 2.55 Å, Crystal structure of CC chemokine 5 (CCL5) oligomer in complex with heparin

Browse structure collections

About this viewer

MolViewer shows 6AEZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.