6EZI: PDZK1 domain 4

PDZK1 domain 4 in complex with C-terminal peptide of human PepT2. Determined by X-ray diffraction at 1.5 Å resolution. Released 26 Sept 2018.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Homo sapiens
Chains: 2
Atoms: 917
Mol. weight: 10.95 kDa
Released: 26 Sept 2018

Explore 6EZI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6EZI contains 4 α-helices and 9 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	376-382	7	1
β-strand	384	1	2
β-strand	387	1	2
β-strand	391-395	5	1
β-strand	402-404	3	1
α-helix	406-407	2
α-helix	411-415	5
α-helix	421	1
β-strand	422-426	5	1
β-strand	429-430	2	1
α-helix	436-444	9
β-strand	449-455	7	1

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	724-728	5	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Na(+)/H(+) exchange regulatory cofactor NHE-RF3	A	protein	89	Homo sapiens	Q5T2W1 (AlphaFold model)
Solute carrier family 15 member 2	B	protein	10	Homo sapiens	Q16348 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6EZI_1 Na(+)/H(+) exchange regulatory cofactor NHE-RF3 (chains A)
SMHKPKLCRLAKGENGYGFHLNAIRGLPGSFIKEVQKGGPADLAGLEDEDVIIEVNGVNV
LDEPYEKVVDRIQSSGKNVTLLVCGKKAY

Sequence of entity 2 (B), FASTA

>6EZI_2 Solute carrier family 15 member 2 (chains B)
IKLETKKTKL

Primary citation

Probing the Architecture of a Multi-PDZ Domain Protein: Structure of PDZK1 in Solution. Hajizadeh, N.R., Pieprzyk, J., Skopintsev, P. et al. Structure (2018) 26:1522-1533.e5. DOI 10.1016/j.str.2018.07.016 · PubMed

Other PDB entries of the same protein (UniProt Q5T2W1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9RXO 1.2 Å, Structure of the PDZ2 domain from human PDZK1 (NHERF3) with the C-terminal residues…
9RXN 1.36 Å, Structure of the PDZ1 domain from human PDZK1 (NHERF3) with the C-terminal residues…
9RXP 1.43 Å, Structure of the PDZ4 domain from human PDZK1 (NHERF3) with the C-terminal residues…
9RXR 1.69 Å, Structure of the PDZ1 domain from human PDZK1 (NHERF3) with the C-terminal residues…
9RXS 2.0 Å, Structure of the PDZ4 domain from human PDZK1 (NHERF3) with the C-terminal residues…
4Q2P 2.05 Å, NHERF3 PDZ2 in Complex with a Phage-Derived Peptide
2VSP 2.41 Å, Crystal structure of the fourth PDZ domain of PDZ domain-containing protein 1
3TMH 3.8 Å, Crystal structure of dual-specific A-kinase anchoring protein 2 in complex with…
2EEI Solution Structure of Second PDZ domain of PDZ Domain Containing Protein 1
2EEJ Solution Structure of Fourth PDZ domain of PDZ Domain Containing Protein 1

Browse structure collections

About this viewer

MolViewer shows 6EZI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.