6KTO: Human SHLD3-C-REV7-O-REV7-SHLD2 complex

Crystal structure of human SHLD3-C-REV7-O-REV7-SHLD2 complex. Determined by X-ray diffraction at 3.45 Å resolution. Released 29 Apr 2020.

Method: X-ray diffraction
Resolution: 3.45 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,710
Mol. weight: 65.73 kDa
Released: 29 Apr 2020

Explore 6KTO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6KTO contains 19 α-helices and 24 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	16-34	19
α-helix	39-41	3
β-strand	42-47	6	1
β-strand	50-55	6	1
α-helix	58-69	12
α-helix	72-76	5
β-strand	80-88	9	2
β-strand	94-103	10	2
α-helix	116-122	7
α-helix	124-131	8
α-helix	133-136	4
α-helix	138-141	4
β-strand	145-152	8	2
α-helix	157-162	6
β-strand	171	1	3
α-helix	173-175	3
α-helix	176-179	4
β-strand	184-193	10	2
β-strand	198-206	9	2

Chain B: 6 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	11-34	24
α-helix	39-41	3
β-strand	42-47	6	4
β-strand	50-55	6	4
α-helix	58-76	19
β-strand	82-88	7	5
β-strand	94-101	8	5
α-helix	112-117	6
α-helix	119-133	15
α-helix	139-141	3
β-strand	145-146	2	5
β-strand	148-151	4	5
β-strand	200-205	6	5
β-strand	206	1	6

Chain C: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	4-9	6	5
α-helix	19-27	9
β-strand	32	1	6
α-helix	33-34	2
β-strand	51	1	2
β-strand	53	1	3

Chain D: 0 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	6-7	2	5
β-strand	10	1	5
β-strand	37-43	7	5
β-strand	48-50	3	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mitotic spindle assembly checkpoint protein MAD2B	A, B	protein	227	Homo sapiens	Q9UI95 (AlphaFold model)
Shieldin complex subunit 3	C	protein	64	Homo sapiens	Q6ZNX1 (AlphaFold model)
Shieldin complex subunit 2	D	protein	54	Homo sapiens	Q86V20 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6KTO_1 Mitotic spindle assembly checkpoint protein MAD2B (chains A, B)
MGSSHHHHHHSQDPNSMTTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQK
RKKYNVPVQMSCHPELNQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQ
PPLLSISSDSLLSHVEQLLRAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQ
VIKDFPWILADEQDVHMHDPRLIPLKTMTSDILKMQLYVEERAHKGS

Sequence of entity 2 (C), FASTA

>6KTO_2 Shieldin complex subunit 3 (chains C)
MTTEVILHYRPCESDPTQLPKIAEKAIQDFPTRPLSRFIPWFPYDGSKLPLRPKRSPPVI
SEEA

Sequence of entity 3 (D), FASTA

>6KTO_3 Shieldin complex subunit 2 (chains D)
MGMSGGSQVHIFWGAPIAPLKITVSEDTASLMSVADPWKKIQLLYSQHSLYLKD

Primary citation

Molecular basis for assembly of the shieldin complex and its implications for NHEJ. Liang, L., Feng, J., Zuo, P. et al. Nat Commun (2020) 11:1972-1972. DOI 10.1038/s41467-020-15879-5 · PubMed

Other PDB entries of the same protein (UniProt Q9UI95 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6BCD 1.43 Å, Crystal structure of Rev7-K44A/R124A/A135D in complex with Rev3-RBM2 (residues 1988-2014)
6BC8 1.68 Å, Crystal structure of Rev7-R124A/Rev3-RBM2 (residues 1988-2014) complex
6M7B 1.77 Å, Structure of REV7-R124A complexed with SHLD3(37-73)
3ABD 1.9 Å, Structure of human REV7 in complex with a human REV3 fragment in a monoclinic crystal
4EXT 1.9 Å, Structure of polymerase-interacting domain of human Rev1 in complex with translesional…
6M7A 1.9 Å, Structure of REV7-R124A complexed with SHLD3(28-73)
6VE5 2.0 Å, X-ray structure of human REV7 in complex with Shieldin3 (residues 41-74)
6NIF 2.0 Å, crystal structure of human REV7-RAN complex
5XPT 2.1 Å, Crystal structure of MAD2L2/REV7 in complex with a CAMP fragment in a tetragonal crystal
6K07 2.24 Å, Crystal structure of REV7(R124A) in complex with a Shieldin3 fragment
6WS0 2.24 Å, Rational drug design of phenazopyridine derivatives as novel inhibitors of Rev1-CT
5XPU 2.3 Å, Crystal structure of MAD2L2/REV7 in complex with a CAMP fragment in a monoclinic crystal

Browse structure collections

About this viewer

MolViewer shows 6KTO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.