6L10: PHF20L1 Tudor1 - MES

PHF20L1 Tudor1 - MES. Determined by X-ray diffraction at 1.6 Å resolution. Released 23 Sept 2020.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,653
Mol. weight: 35.94 kDa
Released: 23 Sept 2020

Explore 6L10 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6L10 contains 10 α-helices and 26 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	4-6	3
β-strand	18-22	5	1
β-strand	28-37	10	1
β-strand	42-47	6	1
β-strand	50	1	2
α-helix	52-54	3
β-strand	56-59	4	1
β-strand	65-66	2	1
α-helix	67-69	3

Chain B: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	7-8	2	3
β-strand	11-12	2	3
β-strand	18-22	5	4
β-strand	28-37	10	4
β-strand	42-47	6	4
β-strand	50	1	2
α-helix	52-54	3
β-strand	56-59	4	4
β-strand	65-66	2	4
α-helix	67-69	3

Chain C: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	7-8	2	5
β-strand	11-12	2	5
β-strand	18-22	5	6
β-strand	28-37	10	6
β-strand	42-47	6	6
α-helix	52-54	3
β-strand	56-59	4	6
β-strand	65-66	2	6
α-helix	67-69	3

Chain D: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	4-6	3
β-strand	18-22	5	7
β-strand	28-37	10	7
β-strand	42-47	6	7
α-helix	52-54	3
β-strand	56-59	4	7
β-strand	65-66	2	7
α-helix	67-69	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
PHD finger protein 20-like protein 1	A, B, C, D	protein	70	Homo sapiens	A8MW92 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>6L10_1 PHD finger protein 20-like protein 1 (chains A, B, C, D)
GSHMPPNRPGITFEIGARLEALDYLQKWYPSRIEKIDYEEGKMLVHFERWSHRYDEWIYW
DSNRLRPLER

Primary citation

Conformational Selection in Ligand Recognition by the First Tudor Domain of PHF20L1. Lv, M., Gao, J., Li, M. et al. J Phys Chem Lett (2020) 11:7932-7938. DOI 10.1021/acs.jpclett.0c02039 · PubMed

Other PDB entries of the same protein (UniProt A8MW92 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6L1P 1.23 Å, Crystal structure of PHF20L1 in complex with Hit 1
6L0X 1.3 Å, The First Tudor Domain of PHF20L1
21EE 1.34 Å, Crystal structure of human PHF20L1(1-80) in complex with H3K36me
6L1C 1.58 Å, Crystal Structure Of of PHF20L1 Tudor1 Y24L mutant
6L1I 1.85 Å, Crystal Structure Of of PHF20L1 Tudor1 Y24W/Y29W mutant
6L1F 1.9 Å, Crystal structure of PHF20L1 Tudor1 in complex with K142me1 DNMT1
21ED 2.31 Å, Crystal structure of human PHF20L1(85-142)
2EQM Solution structure of the TUDOR domain of PHD finger protein 20-like 1 [Homo sapiens]
2EQU Solution structure of the tudor domain of PHD finger protein 20-like 1
2JTF Solution Structure of the PHF20L1 MBT domain

Browse structure collections

About this viewer

MolViewer shows 6L10 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.