6OG4: Plasminogen

plasminogen binding group A streptococcal M protein. Determined by X-ray diffraction at 1.7 Å resolution. Released 24 Jul 2019.

Method: X-ray diffraction
Resolution: 1.7 Å
Organisms: Homo sapiens, Streptococcus pyogenes
Chains: 3
Atoms: 1,739
Mol. weight: 29.27 kDa
Released: 24 Jul 2019

Explore 6OG4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6OG4 contains 11 α-helices and 18 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	167	1	1
β-strand	180	1	2
α-helix	185	1
β-strand	186	1	2
β-strand	187	1	3
α-helix	188-189	2
α-helix	202-204	3
α-helix	206-208	3
β-strand	216	1	4
β-strand	225-227	3	4
β-strand	228	1	3
β-strand	235-237	3	4
α-helix	240-241	2
β-strand	242	1	1
α-helix	243	1

Chain B: 4 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	167	1	5
β-strand	180	1	6
α-helix	185	1
β-strand	186	1	6
β-strand	187	1	7
α-helix	188-189	2
α-helix	206-208	3
β-strand	216	1	8
β-strand	225-227	3	8
β-strand	228	1	7
β-strand	235-237	3	8
α-helix	240-241	2
β-strand	242	1	5

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	90-121	32

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Plasminogen	A, B	protein	87	Homo sapiens	P00747 (AlphaFold model)
Plasminogen-binding group A streptococcal M-like protein PAM	C	protein	77	Streptococcus pyogenes	P49054 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6OG4_1 Plasminogen (chains A, B)
AAQPAEECMHASGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNP
DRELRPWCFTTDPNKRWELCDIPRCTT

Sequence of entity 2 (C), FASTA

>6OG4_2 Plasminogen-binding group A streptococcal M-like protein PAM (chains C)
GSEELQGLKDDVEKLTADAELQRLKNERHEEAELERLKSERHDHDKKEAERKALEDKLAD
KQEHLNGALRYINEKEA

Primary citation

Structure and Function Characterization of the a1a2 Motifs of Streptococcus pyogenes M Protein in Human Plasminogen Binding. Quek, A.J.H., Mazzitelli, B.A., Wu, G. et al. J Mol Biol (2019) 431:3804-3813. DOI 10.1016/j.jmb.2019.07.003 · PubMed

Other PDB entries of the same protein (UniProt P00747 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5UGG 1.2 Å, Protease Inhibitor
6D3Y 1.32 Å, Highly Potent and Selective Plasmin Inhibitors Based on the Sunflower Trypsin…
5UGD 1.38 Å, Protease Inhibitor
6D40 1.43 Å, Highly Potent and Selective Plasmin Inhibitors Based on the Sunflower Trypsin…
8F7U 1.47 Å, Macrocyclic Plasmin Inhibitor
7UAH 1.57 Å, Macrocyclic plasmin inhibitor
8F7V 1.65 Å, Macrocyclic plasmin inhibitor
5HPG 1.66 Å, Structure and ligand determinants of the recombinant kringle 5 domain of human plasminogen
1KRN 1.67 Å, Structure of kringle 4 at 4C temperature and 1.67 Å resolution
1KI0 1.75 Å, The X-ray Structure of Human Angiostatin
4CIK 1.78 Å, plasminogen kringle 1 in complex with inhibitor
6D3X 1.8 Å, Highly Potent and Selective Plasmin Inhibitors Based on the Sunflower Trypsin…

Browse structure collections

About this viewer

MolViewer shows 6OG4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.