6Q0M: Erbin

Structure of Erbin PDZ derivative E-14 with a high-affinity peptide. Determined by X-ray diffraction at 1.2 Å resolution. Released 13 Nov 2019.

Method: X-ray diffraction
Resolution: 1.2 Å
Organisms: Homo sapiens, synthetic construct
Chains: 4
Atoms: 1,853
Mol. weight: 22.7 kDa
Released: 13 Nov 2019

Explore 6Q0M in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6Q0M contains 5 α-helices and 14 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	1-9	9	1
β-strand	16-20	5	1
β-strand	36-41	6	1
α-helix	55	1
β-strand	56-60	5	1
β-strand	63-64	2	1
α-helix	70-79	10
β-strand	83-91	9	1

Chain C: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	-2	1	1
α-helix	-1-1	3

Chain D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	-2	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Erbin	A, B	protein	94	Homo sapiens	Q96RT1 (AlphaFold model)
peptide	C, D	protein	7	synthetic construct

Sequence of entity 1 (A, B), FASTA

>6Q0M_1 Erbin (chains A, B)
SGSMEIRVRVEKDPEIGFRIAGGVGGRGNPFRPDDDGIFVTRVSPEGPASKLLQPGDKII
QANGYSFINIELGQAISLLKTFQNTVELIIVREV

Sequence of entity 2 (C, D), FASTA

>6Q0M_2 peptide (chains C, D)
YYESDWL

Primary citation

Comprehensive analysis of all evolutionary paths between two divergent PDZ domain specificities. Teyra, J., Ernst, A., Singer, A. et al. Protein Sci (2020) 29:433-442. DOI 10.1002/pro.3759 · PubMed

Other PDB entries of the same protein (UniProt Q96RT1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2H3L 1.0 Å, Crystal Structure of ERBIN PDZ
6Q0N 1.18 Å, Structure of the Erbin PDB domain in complex with a high-affinity peptide
1MFG 1.25 Å, The Structure of ERBIN PDZ domain bound to the Carboxy-terminal tail of the ErbB2 Receptor
7LUL 1.65 Å, Structure of the MM2 Erbin PDZ variant in complex with a high-affinity peptide
2QBW 1.8 Å, The crystal structure of PDZ-Fibronectin fusion protein
6UBH 1.8 Å, Structure of the MM7 Erbin PDZ variant in complex with a high-affinity peptide
1MFL 1.88 Å, The Structure of ERBIN PDZ domain bound to the Carboxy-terminal tail of the ErbB2 Receptor
6Q0U 1.89 Å, Structure of the Erbin PDZ variant E-6a with a high-affinity C-terminal peptide
3CH8 1.9 Å, The crystal structure of PDZ-Fibronectin fusion protein
1N7T ERBIN PDZ domain bound to a phage-derived peptide

Browse structure collections

About this viewer

MolViewer shows 6Q0M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.