6Q1U: Plasmin and peptide complex

Structure of plasmin and peptide complex. Determined by X-ray diffraction at 2.35 Å resolution. Released 15 Apr 2020.

Method: X-ray diffraction
Resolution: 2.35 Å
Organisms: Homo sapiens, Helianthus annuus
Chains: 4
Atoms: 4,101
Mol. weight: 57.79 kDa
Ligands: WMH
Released: 15 Apr 2020

Explore 6Q1U in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6Q1U contains 22 α-helices and 44 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	554-556	3
β-strand	563	1	1
β-strand	566-567	2	2
α-helix	568-569	2
β-strand	576-581	6	3
β-strand	586-594	9	3
β-strand	597-600	4	3
α-helix	602-605	4
α-helix	611-613	3
β-strand	614-618	5	3
β-strand	622	1	4
β-strand	631-640	10	3
β-strand	648-652	5	3
α-helix	655-657	3
β-strand	659	1	5
β-strand	662	1	5
α-helix	664-665	2
β-strand	666	1	2
α-helix	667-669	3
α-helix	674-675	2
β-strand	679-684	6	2
β-strand	696	1	4
β-strand	698-705	8	2
α-helix	707-710	4
β-strand	724-727	4	2
β-strand	735	1	1
β-strand	744-749	6	2
β-strand	752-762	11	2
β-strand	767	1	6
β-strand	770	1	6
β-strand	772-776	5	2
α-helix	777-780	4
α-helix	781-790	10

Chain B: 11 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	554-557	4
β-strand	563	1	7
β-strand	566-567	2	8
α-helix	568-569	2
β-strand	576-580	5	9
β-strand	586-592	7	9
β-strand	597-600	4	9
α-helix	602-605	4
α-helix	611-613	3
β-strand	615-618	4	9
β-strand	622	1	10
β-strand	631-640	10	9
β-strand	648-652	5	9
α-helix	655-657	3
α-helix	664-665	2
β-strand	666	1	8
α-helix	667-669	3
α-helix	674-675	2
β-strand	679-684	6	8
β-strand	696	1	10
β-strand	698-705	8	8
α-helix	707-710	4
β-strand	724-727	4	8
β-strand	735	1	7
β-strand	744-749	6	8
β-strand	752-762	11	8
β-strand	772-776	5	8
α-helix	777-779	3
α-helix	781-790	10

Chains C and D: 0 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	3-4	2	2
β-strand	10-11	2	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Plasminogen	A, B	protein	249	Homo sapiens	P00747 (AlphaFold model)
Gly-arg-ala-tyr-lys-ser-lys-pro-pro-ile-ala-phe-pro-asp	C, D	protein	14	Helianthus annuus	Q4GWU5 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6Q1U_1 Plasminogen (chains A, B)
APSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAA
HCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKV
IPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQS
TELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVT
WIEGVMRNN

Sequence of entity 2 (C, D), FASTA

>6Q1U_2 GLY-ARG-ALA-TYR-LYS-SER-LYS-PRO-PRO-ILE-ALA-PHE-PRO-ASP (chains C, D)
GRAYKSKPPIAFPD

Ligands and cofactors

ID	Name	Formula	Copies
WMH	1-methyl-1H-1,2,3-triazole	C3 H5 N3	2

Primary citation

Application and Structural Analysis of Triazole-Bridged Disulfide Mimetics in Cyclic Peptides. White, A.M., de Veer, S.J., Wu, G. et al. Angew Chem Int Ed Engl (2020) 59:11273-11277. DOI 10.1002/anie.202003435 · PubMed

Other PDB entries of the same protein (UniProt P00747 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5UGG 1.2 Å, Protease Inhibitor
6D3Y 1.32 Å, Highly Potent and Selective Plasmin Inhibitors Based on the Sunflower Trypsin…
5UGD 1.38 Å, Protease Inhibitor
6D40 1.43 Å, Highly Potent and Selective Plasmin Inhibitors Based on the Sunflower Trypsin…
8F7U 1.47 Å, Macrocyclic Plasmin Inhibitor
7UAH 1.57 Å, Macrocyclic plasmin inhibitor
8F7V 1.65 Å, Macrocyclic plasmin inhibitor
5HPG 1.66 Å, Structure and ligand determinants of the recombinant kringle 5 domain of human plasminogen
1KRN 1.67 Å, Structure of kringle 4 at 4C temperature and 1.67 Å resolution
6OG4 1.7 Å, plasminogen binding group A streptococcal M protein
1KI0 1.75 Å, The X-ray Structure of Human Angiostatin
4CIK 1.78 Å, plasminogen kringle 1 in complex with inhibitor

Browse structure collections

About this viewer

MolViewer shows 6Q1U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.