6SLR: Saposin B

Structure of saposin B in complex with atovaquone. Determined by X-ray diffraction at 2.38 Å resolution. Released 9 Sept 2020.

Method: X-ray diffraction
Resolution: 2.38 Å
Organism: Homo sapiens
Chains: 3
Atoms: 1,997
Mol. weight: 27.91 kDa
Ligands: AOQ
Released: 9 Sept 2020

Explore 6SLR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6SLR contains 15 α-helices and 0 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	1-20	20
α-helix	24-35	12
α-helix	36-39	4
α-helix	41-63	23
α-helix	67-74	8

Chain B: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	-1-20	22
α-helix	24-35	12
α-helix	36-39	4
α-helix	43-63	21
α-helix	67-74	8

Chain C: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	-1-20	22
α-helix	24-34	11
α-helix	35-38	4
α-helix	44-63	20
α-helix	67-74	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Prosaposin	A, B, C	protein	81	Homo sapiens	P07602 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>6SLR_1 Prosaposin (chains A, B, C)
GASGDVCQDCIQMVTDIQTAVRTNSTFVQALVEHVKEECDRLGPGMADICKNYISQYSEI
AIQMMMHMQPKEICALVGFCD

Ligands and cofactors

ID	Name	Formula	Copies
AOQ	2-[trans-4-(4-chlorophenyl)cyclohexyl]-3-hydroxynaphthalene-1,4-dione	C22 H19 Cl O3	2

Water and common crystallization additives (GOL) are not listed.

Primary citation

Structure of saposin B in complex with atovaquone. Zubieta, C., Milliken, B., Doyle, R. To be published.

Other PDB entries of the same protein (UniProt P07602 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3BQP 1.3 Å, Crystal Structure of Human Saposin D (orthorhombic)
9I63 1.65 Å, Synthetic Human Saposin D glycoprotein
4UEX 1.8 Å, Structure of human Saposin A at lysosomal pH
4DDJ 1.9 Å, Crystal structure of saposin A in complex with lauryldimethylamine-N-oxide (LDAO)
2DOB 2.0 Å, Crystal Structure of Human Saposin A
3BQQ 2.0 Å, Crystal Structure of Human Saposin D (triclinic)
2RB3 2.1 Å, Crystal Structure of Human Saposin D
4V2O 2.13 Å, Structure of saposin B in complex with chloroquine
1N69 2.2 Å, Crystal structure of human saposin B
2GTG 2.4 Å, Crystal Structure of Human Saposin C
2QYP 2.45 Å, Orthorhombic Crystal Structure of Human Saposin C Dimer in Open Conformation
2R0R 2.5 Å, Crystal Structure of Human Saposin D variant SapD K9E

Browse structure collections

About this viewer

MolViewer shows 6SLR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.