6SN1: Human INTS13-INTS14 complex

Crystal structure of the human INTS13-INTS14 complex. Determined by X-ray diffraction at 2.54 Å resolution. Released 22 Jul 2020.

Method: X-ray diffraction
Resolution: 2.54 Å
Organism: Homo sapiens
Chains: 2
Atoms: 8,015
Mol. weight: 144.17 kDa
Released: 22 Jul 2020

Explore 6SN1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6SN1 contains 55 α-helices and 42 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 29 helices, 23 β-strands

Element	Residues	Length	Sheet
α-helix	6-8	3
β-strand	9-15	7	1
α-helix	18-21	4
β-strand	23-28	6	2
α-helix	42-46	5
β-strand	47-50	4	2
α-helix	51-69	19
β-strand	75-81	7	1
β-strand	85-87	3	1
α-helix	93-95	3
α-helix	98-108	11
α-helix	123-133	11
β-strand	135	1	3
α-helix	136-137	2
α-helix	138-147	10
β-strand	157-164	8	1
α-helix	169-191	23
β-strand	196	1	3
β-strand	201-210	10	1
α-helix	215-216	2
β-strand	221-225	5	1
β-strand	230-238	9	1
α-helix	241-254	14
β-strand	257-263	7	4
β-strand	281-286	6	4
α-helix	287-290	4
β-strand	314-319	6	4
α-helix	320	1
β-strand	331-336	6	4
β-strand	338-339	2	4
α-helix	345-356	12
β-strand	360-364	5	4
β-strand	372-380	9	4
β-strand	383-389	7	4
α-helix	390	1
α-helix	399-401	3
β-strand	413	1	5
α-helix	415-424	10
β-strand	426	1	6
β-strand	427-429	3	7
α-helix	441-443	3
α-helix	444-455	12
β-strand	462	1	5
α-helix	463-465	3
α-helix	468-470	3
α-helix	472-474	3
α-helix	475-481	7
α-helix	488-507	20
α-helix	525-541	17
α-helix	544-546	3
α-helix	548-560	13
α-helix	562-563	2

Chain B: 26 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	3-8	6	8
α-helix	11-14	4
β-strand	16	1	9
β-strand	26	1	9
α-helix	27-45	19
β-strand	51-56	6	8
β-strand	60-67	8	8
α-helix	70-76	7
α-helix	88-103	16
β-strand	109-115	7	8
α-helix	126-131	6
α-helix	144	1
α-helix	146	1
β-strand	150-156	7	8
α-helix	160-164	5
α-helix	168-178	11
β-strand	183-186	4	8
α-helix	194-208	15
β-strand	212-218	7	6
β-strand	221-228	8	6
α-helix	230-233	4
β-strand	234	1	10
α-helix	244	1
β-strand	245	1	10
β-strand	250-258	9	6
α-helix	259-262	4
β-strand	266	1	4
β-strand	269-275	7	6
α-helix	298-304	7
α-helix	309-320	12
β-strand	322-329	8	6
β-strand	332-338	7	6
β-strand	348-352	5	6
α-helix	353-354	2
α-helix	361-363	3
α-helix	366-368	3
β-strand	369-371	3	7
α-helix	372-374	3
α-helix	391-393	3
α-helix	398-400	3
α-helix	409-423	15
α-helix	430-447	18
α-helix	450-465	16
α-helix	473-490	18
α-helix	504-506	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Integrator complex subunit 13	A	protein	763	Homo sapiens	Q9NVM9 (AlphaFold model)
Integrator complex subunit 14	B	protein	518	Homo sapiens	Q96SY0 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6SN1_1 Integrator complex subunit 13 (chains A)
MASAWSHPQFEKGGGSGGGSGGSAWSHPQFEKSSGSGSGLEVLFQGPSDPGPKRAEFMKI
FSESHKTVFVVDHCPYMAESCRQHVEFDMLVKNRTQGIIPLAPISKSLWTCSVESSMEYC
RIMYDIFPFKKLVNFIVSDSGAHVLNSWTQEDQNLQELMAALAAVGPPNPRADPECCSIL
HGLVAAVETLCKITEYQHEARTLLMENAERVGNRGRIICITNAKSDSHVRMLEDCVQETI
HEHNKLAANSDHLMQIQKCELVLIHTYPVGEDSLVSDRSKKELSPVLTSEVHSVRAGRHL
ATKLNILVQQHFDLASTTITNIPMKEEQHANTSANYDVELLHHKDAHVDFLKSGDSHLGG
GSREGSFKETITLKWCTPRTNNIELHYCTGAYRISPVDVNSRPSSCLTNFLLNGRSVLLE
QPRKSGSKVISHMLSSHGGEIFLHVLSSSRSILEDPPSISEGCGGRVTDYRITDFGEFMR
ENRLTPFLDPRYKIDGSLEVPLERAKDQLEKHTRYWPMIISQTTIFNMQAVVPLASVIVK
ESLTEEDVLNCQKTIYNLVDMERKNDPLPISTVGTRGKGPKRDEQYRIMWNELETLVRAH
INNSEKHQRVLECLMACRSKPPEEEERKKRGRKREDKEDKSEKAVKDYEQEKSWQDSERL
KGILERGKEELAEAEIIKDSPDSPEPPNKKPLVEMDETPQVEKSKGPVSLLSLWSNRINT
ANSRKHQEFAGRLNSVNNRAELYQHLKEENGMETTENGKASRQ

Sequence of entity 2 (B), FASTA

>6SN1_2 Integrator complex subunit 14 (chains B)
MPTVVVMDVSLSMTRPVSIEGSEEYQRKHLAAHGLTMLFEHMATNYKLEFTALVVFSSLW
ELMVPFTRDYNTLQEALSNMDDYDKTCLESALVGVCNIVQQEWGGAIPCQVVLVTDGCLG
IGRGSLRHSLATQNQRSESNRFPLPFPFPSKLYIMCMANLEELQSTDSLECLERLIDLNN
GEGQIFTIDGPLCLKNVQSMFGKLIDLAYTPFHAVLKCGHLTADVQVFPRPEPFVVDEEI
DPIPKVINTDLEIVGFIDIADISSPPVLSRHLVLPIALNKEGDEVGTGITDDNEDENSAN
QIAGKIPNFCVLLHGSLKVEGMVAIVQLGPEWHGMLYSQADSKKKSNLMMSLFEPGPEPL
PWLGKMAQLGPISDAKENPYGEDDNKSPFPLQPKNKRSYAQNVTVWIKPSGLQTDVQKIL
RNARKLPEKTQTFYKELNRLRKAALAFGFLDLLKGVADMLERECTLLPETAHPDAAFQLT
HAAQQLKLASTGTSEYAAYDQNITPLHTDFSGSSTERI

Primary citation

INTS10-INTS13-INTS14 form a functional module of Integrator that binds nucleic acids and the cleavage module. Sabath, K., Staubli, M.L., Marti, S. et al. Nat Commun (2020) 11:3422-3422. DOI 10.1038/s41467-020-17232-2 · PubMed

Other PDB entries of the same protein (UniProt Q9NVM9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8PK5 2.5 Å, INTS13-INTS14 complex with ZNF609
8RC4 3.1 Å, Structure of Integrator-PP2A complex
8PK6 3.21 Å, INTS13 complex with ZNF655
9EOC 3.3 Å, Structure of the Integrator arm module containing INTS10/13/14 subunits
8RBZ 3.7 Å, Structure of Integrator-PP2A-SOSS-CTD post-termination complex
9EP1 4.0 Å, Structure of the Integrator arm module containing INTS10/13/14/15 subunits (state 2)
9FA4 4.0 Å, Structure of the Integrator arm module containing subunits INTS10/13/14/15 (state 1)
9FA7 4.0 Å, Structure of the Integrator arm module containing subunits INTS10/13/14/15 (state 3)
8RBX 4.1 Å, Structure of Integrator-PP2A bound to a paused RNA polymerase II-DSIF-NELF-nucleosome…

Browse structure collections

About this viewer

MolViewer shows 6SN1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.