8PK5: INTS13-INTS14 complex with ZNF609

INTS13-INTS14 complex with ZNF609. Determined by X-ray diffraction at 2.5 Å resolution. Released 3 Jul 2024.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 2
Atoms: 8,017
Mol. weight: 141.22 kDa
Ligands: MG
Released: 3 Jul 2024

Explore 8PK5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8PK5 contains 48 α-helices and 51 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 24 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	0	1	1
β-strand	9-15	7	2
α-helix	18-21	4
β-strand	23	1	3
β-strand	28	1	4
α-helix	43-46	4
β-strand	47	1	4
β-strand	50	1	3
α-helix	51-69	19
β-strand	75-81	7	2
β-strand	85-87	3	2
α-helix	98-108	11
α-helix	123-132	10
β-strand	135	1	5
α-helix	138-147	10
β-strand	154	1	1
β-strand	157-164	8	2
α-helix	169-191	23
β-strand	196	1	5
β-strand	201-210	10	2
α-helix	215-216	2
β-strand	221-225	5	2
β-strand	230-238	9	2
α-helix	241-255	15
β-strand	257-269	13	6
β-strand	277-286	10	6
α-helix	287-290	4
β-strand	313-318	6	6
α-helix	320-322	3
β-strand	331-339	9	6
α-helix	345-355	11
β-strand	359-363	5	6
β-strand	373-380	8	6
β-strand	383-389	7	6
α-helix	393-394	2
α-helix	399-401	3
α-helix	402-404	3
β-strand	413	1	7
α-helix	415-424	10
β-strand	426	1	8
β-strand	427-429	3	9
β-strand	435-436	2	10
β-strand	441-442	2	10
α-helix	444-455	12
β-strand	462	1	7
α-helix	463-465	3
α-helix	468-470	3
α-helix	472-474	3
α-helix	475-481	7
α-helix	488-507	20
α-helix	525-541	17
α-helix	548-560	13

Chain B: 24 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-8	6	11
α-helix	11-14	4
β-strand	16	1	12
β-strand	26	1	12
α-helix	27-45	19
β-strand	51-56	6	11
β-strand	60-67	8	11
α-helix	70-78	9
β-strand	87	1	11
α-helix	91-103	13
β-strand	109-115	7	11
α-helix	144	1
α-helix	146	1
β-strand	150-159	10	11
α-helix	160-164	5
α-helix	168-178	11
β-strand	183-188	6	11
α-helix	194-208	15
β-strand	213-218	6	8
β-strand	221-228	8	8
α-helix	230-233	4
β-strand	234	1	13
β-strand	237	1	14
β-strand	241	1	14
β-strand	245	1	13
β-strand	250-258	9	8
α-helix	259-262	4
β-strand	266	1	6
β-strand	269-275	7	8
α-helix	299-304	6
α-helix	309-320	12
β-strand	322-329	8	8
β-strand	332-338	7	8
β-strand	348-352	5	8
α-helix	353-354	2
α-helix	361-363	3
α-helix	366-368	3
β-strand	369-371	3	9
α-helix	372-374	3
α-helix	389-391	3
α-helix	398-400	3
α-helix	409-424	16
α-helix	430-447	18
α-helix	450-466	17
α-helix	474-490	17
α-helix	502-506	5
β-strand	531-533	3	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Integrator complex subunit 13	A	protein	718	Homo sapiens	Q9NVM9 (AlphaFold model)
Integrator complex subunit 14,Zinc finger protein 609	B	protein	538	Homo sapiens	O15014 (AlphaFold model), Q96SY0 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8PK5_1 Integrator complex subunit 13 (chains A)
GPSDPGPKRAEFMKIFSESHKTVFVVDHCPYMAESCRQHVEFDMLVKNRTQGIIPLAPIS
KSLWTCSVESSMEYCRIMYDIFPFKKLVNFIVSDSGAHVLNSWTQEDQNLQELMAALAAV
GPPNPRADPECCSILHGLVAAVETLCKITEYQHEARTLLMENAERVGNRGRIICITNAKS
DSHVRMLEDCVQETIHEHNKLAANSDHLMQIQKCELVLIHTYPVGEDSLVSDRSKKELSP
VLTSEVHSVRAGRHLATKLNILVQQHFDLASTTITNIPMKEEQHANTSANYDVELLHHKD
AHVDFLKSGDSHLGGGSREGSFKETITLKWCTPRTNNIELHYCTGAYRISPVDVNSRPSS
CLTNFLLNGRSVLLEQPRKSGSKVISHMLSSHGGEIFLHVLSSSRSILEDPPSISEGCGG
RVTDYRITDFGEFMRENRLTPFLDPRYKIDGSLEVPLERAKDQLEKHTRYWPMIISQTTI
FNMQAVVPLASVIVKESLTEEDVLNCQKTIYNLVDMERKNDPLPISTVGTRGKGPKRDEQ
YRIMWNELETLVRAHINNSEKHQRVLECLMACRSKPPEEEERKKRGRKREDKEDKSEKAV
KDYEQEKSWQDSERLKGILERGKEELAEAEIIKDSPDSPEPPNKKPLVEMDETPQVEKSK
GPVSLLSLWSNRINTANSRKHQEFAGRLNSVNNRAELYQHLKEENGMETTENGKASRQ

Sequence of entity 2 (B), FASTA

>8PK5_2 Integrator complex subunit 14,Zinc finger protein 609 (chains B)
MPTVVVMDVSLSMTRPVSIEGSEEYQRKHLAAHGLTMLFEHMATNYKLEFTALVVFSSLW
ELMVPFTRDYNTLQEALSNMDDYDKTCLESALVGVCNIVQQEWGGAIPCQVVLVTDGCLG
IGRGSLRHSLATQNQRSESNRFPLPFPFPSKLYIMCMANLEELQSTDSLECLERLIDLNN
GEGQIFTIDGPLCLKNVQSMFGKLIDLAYTPFHAVLKCGHLTADVQVFPRPEPFVVDEEI
DPIPKVINTDLEIVGFIDIADISSPPVLSRHLVLPIALNKEGDEVGTGITDDNEDENSAN
QIAGKIPNFCVLLHGSLKVEGMVAIVQLGPEWHGMLYSQADSKKKSNLMMSLFEPGPEPL
PWLGKMAQLGPISDAKENPYGEDDNKSPFPLQPKNKRSYAQNVTVWIKPSGLQTDVQKIL
RNARKLPEKTQTFYKELNRLRKAALAFGFLDLLKGVADMLERECTLLPETAHPDAAFQLT
HAAQQLKLASTGTSEYAAYDQNITPLHTDFSGSSTERISGSDEWDIGVGNLIIDLDAD

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1

Primary citation

Basis of gene-specific transcription regulation by the Integrator complex. Sabath, K., Nabih, A., Arnold, C. et al. Mol Cell (2024) 84:2525. DOI 10.1016/j.molcel.2024.05.027 · PubMed

Other PDB entries of the same protein (UniProt Q9NVM9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6SN1 2.54 Å, Crystal structure of the human INTS13-INTS14 complex
8RC4 3.1 Å, Structure of Integrator-PP2A complex
8PK6 3.21 Å, INTS13 complex with ZNF655
9EOC 3.3 Å, Structure of the Integrator arm module containing INTS10/13/14 subunits
8RBZ 3.7 Å, Structure of Integrator-PP2A-SOSS-CTD post-termination complex
9EP1 4.0 Å, Structure of the Integrator arm module containing INTS10/13/14/15 subunits (state 2)
9FA4 4.0 Å, Structure of the Integrator arm module containing subunits INTS10/13/14/15 (state 1)
9FA7 4.0 Å, Structure of the Integrator arm module containing subunits INTS10/13/14/15 (state 3)
8RBX 4.1 Å, Structure of Integrator-PP2A bound to a paused RNA polymerase II-DSIF-NELF-nucleosome…

Browse structure collections

About this viewer

MolViewer shows 8PK5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.