8PK6: INTS13 complex with ZNF655

INTS13 complex with ZNF655. Determined by X-ray diffraction at 3.21 Å resolution. Released 3 Jul 2024.

Method: X-ray diffraction
Resolution: 3.21 Å
Organism: Homo sapiens
Chains: 6
Atoms: 5,874
Mol. weight: 93.65 kDa
Released: 3 Jul 2024

Explore 8PK6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8PK6 contains 36 α-helices and 22 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	6-8	3
β-strand	9-14	6	1
α-helix	18-20	3
α-helix	31-49	19
β-strand	55-61	7	1
β-strand	65-67	3	1
α-helix	78-87	10
α-helix	90-92	3
α-helix	103-114	12
α-helix	116-117	2
α-helix	118-126	9
β-strand	138-144	7	1
α-helix	149-172	24
β-strand	182-188	7	1
α-helix	201-203	3
β-strand	213-214	2	1
α-helix	222-233	12

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	96-109	14
α-helix	111-114	4

Chain C: 12 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	2-4	3
β-strand	9-14	6	2
α-helix	18-20	3
α-helix	31-49	19
β-strand	55-60	6	2
β-strand	66-67	2	2
α-helix	78-88	11
α-helix	91-92	2
α-helix	103-114	12
α-helix	116-117	2
α-helix	118-127	10
β-strand	138-144	7	2
α-helix	149-166	18
α-helix	167-171	5
β-strand	182-190	9	2
α-helix	191	1
β-strand	204	1	2
β-strand	210-218	9	2
α-helix	221-234	14

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	98-113	16

Chain E: 9 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	2-4	3
α-helix	6-8	3
β-strand	9-14	6	3
α-helix	31-49	19
β-strand	55-60	6	3
β-strand	66-67	2	3
α-helix	78-88	11
α-helix	103-114	12
β-strand	115	1	4
α-helix	116-117	2
α-helix	118-126	9
β-strand	138-143	6	3
α-helix	149-170	22
β-strand	176	1	4
β-strand	182-189	8	3
β-strand	204	1	3
β-strand	210-217	8	3
α-helix	221-234	14

Chain F: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	95-115	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Integrator complex subunit 13	A, C, E	protein	242	Homo sapiens	Q9NVM9 (AlphaFold model)
Zinc finger protein 655	B, D, F	protein	30	Homo sapiens	Q8N720 (AlphaFold model)

Sequence of entity 1 (A, C, E), FASTA

>8PK6_1 Integrator complex subunit 13 (chains A, C, E)
GPHMLEMKIFSESHKTVFVVDHCPYMAESCRQHSKSLWTCSVESSMEYCRIMYDIFPFKK
LVNFIVSDSGAHVLNSWTQEDQNLQELMAALAAVGPPNPRADPECCSILHGLVAAVETLC
KITEYQHEARTLLMENAERVGNRGRIICITNAKSDSHVRMLEDCVQETIHEHNKLAANSD
HLMQIQKCELVLIHTYPVGEDSLVSDRSKKELSPVLTSEVHSVRAGRHLATKLNILVQQH
FD

Sequence of entity 2 (B, D, F), FASTA

>8PK6_2 Zinc finger protein 655 (chains B, D, F)
GHMEDRLERLQEILRKFLYLEREFRQITIS

Primary citation

Basis of gene-specific transcription regulation by the Integrator complex. Sabath, K., Nabih, A., Arnold, C. et al. Mol Cell (2024) 84:2525. DOI 10.1016/j.molcel.2024.05.027 · PubMed

Other PDB entries of the same protein (UniProt Q9NVM9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8PK5 2.5 Å, INTS13-INTS14 complex with ZNF609
6SN1 2.54 Å, Crystal structure of the human INTS13-INTS14 complex
8RC4 3.1 Å, Structure of Integrator-PP2A complex
9EOC 3.3 Å, Structure of the Integrator arm module containing INTS10/13/14 subunits
8RBZ 3.7 Å, Structure of Integrator-PP2A-SOSS-CTD post-termination complex
9EP1 4.0 Å, Structure of the Integrator arm module containing INTS10/13/14/15 subunits (state 2)
9FA4 4.0 Å, Structure of the Integrator arm module containing subunits INTS10/13/14/15 (state 1)
9FA7 4.0 Å, Structure of the Integrator arm module containing subunits INTS10/13/14/15 (state 3)
8RBX 4.1 Å, Structure of Integrator-PP2A bound to a paused RNA polymerase II-DSIF-NELF-nucleosome…

Browse structure collections

About this viewer

MolViewer shows 8PK6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.