6TWN: Talin1 R7R8

Crystal structure of Talin1 R7R8 in complex with CDK1 (206-223). Determined by X-ray diffraction at 2.28 Å resolution. Released 12 May 2021.

Method: X-ray diffraction
Resolution: 2.28 Å
Organisms: Mus musculus, Homo sapiens
Chains: 4
Atoms: 4,993
Mol. weight: 69.33 kDa
Released: 12 May 2021

Explore 6TWN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6TWN contains 26 α-helices and 8 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	1355-1374	20
α-helix	1375-1377	3
α-helix	1389-1416	28
α-helix	1419-1450	32
β-strand	1455	1	1
β-strand	1458	1	2
α-helix	1464-1482	19
α-helix	1488-1515	28
α-helix	1519-1548	30
α-helix	1552-1576	25
α-helix	1579-1581	3
β-strand	1584	1	2
β-strand	1587	1	1
α-helix	1590-1622	33
α-helix	1627-1654	28
α-helix	1655-1658	4

Chain B: 12 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	1354-1374	21
α-helix	1375-1377	3
α-helix	1389-1416	28
α-helix	1419-1450	32
β-strand	1455	1	3
β-strand	1458	1	4
α-helix	1464-1482	19
α-helix	1488-1515	28
α-helix	1519-1548	30
α-helix	1552-1576	25
α-helix	1579-1581	3
β-strand	1584	1	4
β-strand	1587	1	3
α-helix	1590-1622	33
α-helix	1627-1654	28
α-helix	1655-1658	4

Chains C and D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	208-220	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Talin-1	A, B	protein	309	Mus musculus	P26039 (AlphaFold model)
Cyclin-dependent kinase 1	C, D	protein	17	Homo sapiens	P06493 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6TWN_1 Talin-1 (chains A, B)
GIDPFTKHGQKECDNALRQLETVRELLENPVQPINDMSYFGCLDSVMENSKVLGEAMTGI
SQNAKNGNLPEFGDAIATASKALCGFTEAAAQAAYLVGVSDPNSQAGQQGLVEPTQFARA
NQAIQMACQSLGEPGCTQAQVLSAATIVAKHTSALCNSCRLASARTANPTAKRQFVQSAK
EVANSTANLVKTIKALDGDFTEENRAQCRAATAPLLEAVDNLSAFASNPEFSSVPAQISP
EGRAAMEPIVISAKTMLESAGGLIQTARALAVNPRDPPRWSVLAGHSRTVSDSIKKLITS
MRDKAPGQL

Sequence of entity 2 (C, D), FASTA

>6TWN_2 Cyclin-dependent kinase 1 (chains C, D)
DSEIDQLFRIFRALGTP

Primary citation

Talin mechanosensitivity is modulated by a direct interaction with cyclin-dependent kinase-1. Gough, R.E., Jones, M.C., Zacharchenko, T. et al. J Biol Chem (2021) 297:100837-100837. DOI 10.1016/j.jbc.2021.100837 · PubMed

Other PDB entries of the same protein (UniProt P26039 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9SR0 1.49 Å, Mouse vinculin head domain 1 (VD1) (residues 2-258) with A50I mutation in complex with…
4W8P 1.5 Å, Crystal structure of RIAM TBS1 in complex with talin R7R8 domains
9DZ5 1.74 Å, Crystal structure of integrin beta-2 tail bound to the FERM-folded talin head domain…
7V1A 1.84 Å, Stapled TBS peptide from RIAM bound to talin R7R8 domains
3DYJ 1.85 Å, Crystal Structure of the R11R12 Domains of Talin
8FSE 1.9 Å, Crystal structure of integrin beta-2 tail bound to the FERM-folded talin head domain
3IVF 1.94 Å, Crystal structure of the talin head FERM domain
3S90 1.97 Å, Human vinculin head domain Vh1 (residues 1-252) in complex with murine talin (VBS33;…
5IC0 1.97 Å, Structural analysis of a talin triple domain module
8FTB 1.97 Å, Crystal structure of integrin beta-2 tail bound to the FERM-folded talin head domain…
2X0C 2.0 Å, Crystal Structure of the R7R8 domains of Talin
4F7G 2.05 Å, Crystal structure of talin autoinhibition complex

Browse structure collections

About this viewer

MolViewer shows 6TWN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.